# PaCkAgE DaTaStReAm RCnmh 1 8080 # end of header 0707010000ceed000081a400000064000000640000000134f7e5af000000d2000000200000001b00000000000000000000000e00000004RCnmh/pkginfoPKG=RCnmh NAME=nmh (+pop +mts=sendmail) DESC=New MH ARCH=sparc MAXINST=1000 VERSION=0.24,REV=6 CATEGORY=application VENDOR=Richard Coleman EMAIL=dj@gregor.com BASEDIR=/ CLASSES=none PSTAMP=bertrand980228052342 0707010000ceec000081a400000064000000640000000134f7e5af000023b1000000200000001b00000000000000000000000d00000004RCnmh/pkgmap: 1 8080 1 i copyright 987 26077 888679323 1 d none opt/RCnmh 0755 root root 1 f none opt/RCnmh/COPYRIGHT 0644 root root 987 26077 888679323 1 d none opt/RCnmh/bin 0755 root root 1 f none opt/RCnmh/bin/ali 0755 root root 57188 32042 888679331 1 f none opt/RCnmh/bin/anno 0755 root root 58296 15070 888679332 1 f none opt/RCnmh/bin/burst 0755 root root 54188 22816 888679332 1 f none opt/RCnmh/bin/comp 0755 root root 86648 46934 888679333 1 f none opt/RCnmh/bin/dist 0755 root root 86572 4977 888679334 1 f none opt/RCnmh/bin/flist 0755 root root 45488 38156 888679334 1 l none opt/RCnmh/bin/flists=flist 1 f none opt/RCnmh/bin/folder 0755 root root 57400 47228 888679335 1 l none opt/RCnmh/bin/folders=folder 1 f none opt/RCnmh/bin/forw 0755 root root 142128 7554 888679336 1 f none opt/RCnmh/bin/inc 0755 root root 135832 35936 888679337 1 f none opt/RCnmh/bin/mark 0755 root root 53272 21451 888679337 1 f none opt/RCnmh/bin/mhbuild 0755 root root 108956 52567 888679338 1 f none opt/RCnmh/bin/mhmail 0755 root root 39440 25828 888679339 1 f none opt/RCnmh/bin/mhn 0755 root root 137424 14117 888679340 1 f none opt/RCnmh/bin/mhparam 0755 root root 38976 57854 888679340 1 f none opt/RCnmh/bin/mhpath 0755 root root 50612 41137 888679341 1 f none opt/RCnmh/bin/msgchk 0755 root root 43188 49531 888679341 1 f none opt/RCnmh/bin/msh 0755 root root 220924 44820 888679342 1 l none opt/RCnmh/bin/next=show 1 f none opt/RCnmh/bin/packf 0755 root root 62856 53320 888679343 1 f none opt/RCnmh/bin/pick 0755 root root 84376 34265 888679344 1 l none opt/RCnmh/bin/prev=show 1 f none opt/RCnmh/bin/prompter 0755 root root 42204 15165 888679344 1 f none opt/RCnmh/bin/refile 0755 root root 57020 19182 888679345 1 f none opt/RCnmh/bin/repl 0755 root root 142640 62653 888679346 1 f none opt/RCnmh/bin/rmf 0755 root root 41068 51764 888679347 1 f none opt/RCnmh/bin/rmm 0755 root root 50832 29145 888679348 1 f none opt/RCnmh/bin/scan 0755 root root 127060 61668 888679348 1 f none opt/RCnmh/bin/send 0755 root root 75868 18741 888679349 1 f none opt/RCnmh/bin/show 0755 root root 149940 11719 888679350 1 f none opt/RCnmh/bin/sortm 0755 root root 79864 61350 888679351 1 f none opt/RCnmh/bin/whatnow 0755 root root 81584 46680 888679351 1 f none opt/RCnmh/bin/whom 0755 root root 57064 56504 888679352 1 d none opt/RCnmh/etc 0755 root root 1 f none opt/RCnmh/etc/MailAliases 0644 root root 1100 26608 888679373 1 f none opt/RCnmh/etc/components 0644 root root 26 1687 888679371 1 f none opt/RCnmh/etc/digestcomps 0644 root root 275 22959 888679371 1 f none opt/RCnmh/etc/distcomps 0644 root root 22 1869 888679371 1 f none opt/RCnmh/etc/forwcomps 0644 root root 26 1687 888679372 1 f none opt/RCnmh/etc/mhl.body 0644 root root 46 4238 888679366 1 f none opt/RCnmh/etc/mhl.digest 0644 root root 193 18216 888679366 1 f none opt/RCnmh/etc/mhl.format 0644 root root 379 35353 888679367 1 f none opt/RCnmh/etc/mhl.forward 0644 root root 284 26100 888679367 1 f none opt/RCnmh/etc/mhl.headers 0644 root root 415 37981 888679367 1 f none opt/RCnmh/etc/mhl.reply 0644 root root 122 10678 888679368 1 f none opt/RCnmh/etc/mhn.defaults 0644 root root 386 32635 888679374 1 f none opt/RCnmh/etc/mts.conf 0644 root root 786 3140 888679327 1 f none opt/RCnmh/etc/rcvdistcomps 0644 root root 104 9037 888679372 1 f none opt/RCnmh/etc/replcomps 0644 root root 556 46563 888679372 1 f none opt/RCnmh/etc/replgroupcomps 0644 root root 965 10739 888679373 1 f none opt/RCnmh/etc/scan.default 0644 root root 455 38705 888679368 1 f none opt/RCnmh/etc/scan.mailx 0644 root root 273 22785 888679368 1 f none opt/RCnmh/etc/scan.nomime 0644 root root 378 31699 888679369 1 f none opt/RCnmh/etc/scan.size 0644 root root 245 20462 888679369 1 f none opt/RCnmh/etc/scan.time 0644 root root 284 23925 888679369 1 f none opt/RCnmh/etc/scan.timely 0644 root root 404 32811 888679370 1 f none opt/RCnmh/etc/scan.unseen 0644 root root 252 21047 888679370 1 f none opt/RCnmh/etc/tmac.h 0644 root root 1183 16057 888679376 1 d none opt/RCnmh/lib 0755 root root 1 f none opt/RCnmh/lib/ap 0755 root root 110236 3482 888679355 1 f none opt/RCnmh/lib/conflict 0755 root root 46704 129 888679356 1 f none opt/RCnmh/lib/dp 0755 root root 109780 1769 888679356 1 f none opt/RCnmh/lib/fmtdump 0755 root root 99340 65152 888679357 1 f none opt/RCnmh/lib/install-mh 0755 root root 40040 43002 888679358 1 f none opt/RCnmh/lib/mhl 0755 root root 129264 43645 888679358 1 f none opt/RCnmh/lib/post 0755 root root 83464 53327 888679359 1 f none opt/RCnmh/lib/rcvdist 0755 root root 101936 37149 888679360 1 f none opt/RCnmh/lib/rcvpack 0755 root root 50420 2651 888679360 1 f none opt/RCnmh/lib/rcvstore 0755 root root 50940 47243 888679361 1 f none opt/RCnmh/lib/rcvtty 0755 root root 116236 39984 888679362 1 f none opt/RCnmh/lib/slocal 0755 root root 69324 51203 888679363 1 f none opt/RCnmh/lib/spost 0755 root root 66044 55122 888679363 1 f none opt/RCnmh/lib/viamail 0755 root root 641 48039 888679374 1 d none opt/RCnmh/man 0755 root root 1 d none opt/RCnmh/man/man1 0755 root root 1 f none opt/RCnmh/man/man1/ali.1 0644 root root 1955 38980 888679378 1 f none opt/RCnmh/man/man1/anno.1 0644 root root 1869 30464 888679378 1 f none opt/RCnmh/man/man1/burst.1 0644 root root 3713 5299 888679378 1 f none opt/RCnmh/man/man1/comp.1 0644 root root 4032 28109 888679379 1 f none opt/RCnmh/man/man1/dist.1 0644 root root 5309 13156 888679379 1 f none opt/RCnmh/man/man1/flist.1 0644 root root 4968 44233 888679379 1 f none opt/RCnmh/man/man1/folder.1 0644 root root 6968 14043 888679380 1 f none opt/RCnmh/man/man1/forw.1 0644 root root 7826 42770 888679380 1 f none opt/RCnmh/man/man1/inc.1 0644 root root 5097 60382 888679381 1 f none opt/RCnmh/man/man1/mark.1 0644 root root 5499 31067 888679381 1 f none opt/RCnmh/man/man1/mh-chart.1 0644 root root 9750 39503 888679381 1 f none opt/RCnmh/man/man1/mhbuild.1 0644 root root 18652 3749 888679382 1 f none opt/RCnmh/man/man1/mhl.1 0644 root root 9457 58040 888679383 1 f none opt/RCnmh/man/man1/mhmail.1 0644 root root 2305 3728 888679383 1 f none opt/RCnmh/man/man1/mhn.1 0644 root root 25237 56187 888679384 1 f none opt/RCnmh/man/man1/mhparam.1 0644 root root 1717 16819 888679384 1 f none opt/RCnmh/man/man1/mhpath.1 0644 root root 3060 63391 888679385 1 f none opt/RCnmh/man/man1/msgchk.1 0644 root root 1746 21356 888679385 1 f none opt/RCnmh/man/man1/msh.1 0644 root root 6568 58138 888679385 1 f none opt/RCnmh/man/man1/next.1 0644 root root 1686 14714 888679386 1 f none opt/RCnmh/man/man1/nmh.1 0644 root root 8456 28510 888679382 1 f none opt/RCnmh/man/man1/packf.1 0644 root root 1720 15681 888679386 1 f none opt/RCnmh/man/man1/pick.1 0644 root root 9396 46353 888679386 1 f none opt/RCnmh/man/man1/prev.1 0644 root root 1709 16973 888679387 1 f none opt/RCnmh/man/man1/prompter.1 0644 root root 4323 54018 888679387 1 f none opt/RCnmh/man/man1/rcvdist.1 0644 root root 1896 35502 888679387 1 f none opt/RCnmh/man/man1/rcvpack.1 0644 root root 1164 32769 888679388 1 f none opt/RCnmh/man/man1/rcvstore.1 0644 root root 3475 46656 888679388 1 f none opt/RCnmh/man/man1/rcvtty.1 0644 root root 2521 25263 888679389 1 f none opt/RCnmh/man/man1/refile.1 0644 root root 4546 9903 888679389 1 f none opt/RCnmh/man/man1/repl.1 0644 root root 11065 1620 888679389 1 f none opt/RCnmh/man/man1/rmf.1 0644 root root 2453 20620 888679390 1 f none opt/RCnmh/man/man1/rmm.1 0644 root root 1775 22712 888679390 1 f none opt/RCnmh/man/man1/scan.1 0644 root root 6035 8646 888679390 1 f none opt/RCnmh/man/man1/send.1 0644 root root 7069 36804 888679391 1 f none opt/RCnmh/man/man1/show.1 0644 root root 6194 29296 888679391 1 f none opt/RCnmh/man/man1/slocal.1 0644 root root 11731 46595 888679391 1 f none opt/RCnmh/man/man1/sortm.1 0644 root root 3357 33816 888679392 1 f none opt/RCnmh/man/man1/vmh.1 0644 root root 3409 37054 888679392 1 f none opt/RCnmh/man/man1/whatnow.1 0644 root root 4878 46130 888679392 1 f none opt/RCnmh/man/man1/whom.1 0644 root root 1943 37073 888679393 1 d none opt/RCnmh/man/man5 0755 root root 1 f none opt/RCnmh/man/man5/mh-alias.5 0644 root root 6563 47334 888679394 1 f none opt/RCnmh/man/man5/mh-draft.5 0644 root root 6371 39888 888679394 1 f none opt/RCnmh/man/man5/mh-format.5 0644 root root 17779 2925 888679395 1 f none opt/RCnmh/man/man5/mh-mail.5 0644 root root 6620 46628 888679395 1 f none opt/RCnmh/man/man5/mh-profile.5 0644 root root 19847 63233 888679396 1 f none opt/RCnmh/man/man5/mh-sequence.5 0644 root root 9127 28415 888679396 1 f none opt/RCnmh/man/man5/mh-tailor.5 0644 root root 8643 30098 888679397 1 d none opt/RCnmh/man/man8 0755 root root 1 f none opt/RCnmh/man/man8/ap.8 0644 root root 2284 1859 888679398 1 f none opt/RCnmh/man/man8/conflict.8 0644 root root 1690 15905 888679398 1 f none opt/RCnmh/man/man8/dp.8 0644 root root 1879 30491 888679398 1 f none opt/RCnmh/man/man8/fmtdump.8 0644 root root 1113 29427 888679399 1 f none opt/RCnmh/man/man8/install-mh.8 0644 root root 1818 27942 888679399 1 f none opt/RCnmh/man/man8/mh-mts.8 0644 root root 3714 65223 888679399 1 f none opt/RCnmh/man/man8/post.8 0644 root root 3738 36 888679400 1 i pkginfo 210 16214 888661423 07070100000000000000000000000000000000000000010000000000000000000000000000000000000000000000000000000b00000000TRAILER!!!0707010000ceed000081a400000064000000640000000134f7e5af000000d2000000200000001b00000000000000000000000800000004pkginfoPKG=RCnmh NAME=nmh (+pop +mts=sendmail) DESC=New MH ARCH=sparc MAXINST=1000 VERSION=0.24,REV=6 CATEGORY=application VENDOR=Richard Coleman EMAIL=dj@gregor.com BASEDIR=/ CLASSES=none PSTAMP=bertrand980228052342 0707010000ceec000081a400000064000000640000000134f7e5af000023b1000000200000001b00000000000000000000000700000004pkgmap: 1 8080 1 i copyright 987 26077 888679323 1 d none opt/RCnmh 0755 root root 1 f none opt/RCnmh/COPYRIGHT 0644 root root 987 26077 888679323 1 d none opt/RCnmh/bin 0755 root root 1 f none opt/RCnmh/bin/ali 0755 root root 57188 32042 888679331 1 f none opt/RCnmh/bin/anno 0755 root root 58296 15070 888679332 1 f none opt/RCnmh/bin/burst 0755 root root 54188 22816 888679332 1 f none opt/RCnmh/bin/comp 0755 root root 86648 46934 888679333 1 f none opt/RCnmh/bin/dist 0755 root root 86572 4977 888679334 1 f none opt/RCnmh/bin/flist 0755 root root 45488 38156 888679334 1 l none opt/RCnmh/bin/flists=flist 1 f none opt/RCnmh/bin/folder 0755 root root 57400 47228 888679335 1 l none opt/RCnmh/bin/folders=folder 1 f none opt/RCnmh/bin/forw 0755 root root 142128 7554 888679336 1 f none opt/RCnmh/bin/inc 0755 root root 135832 35936 888679337 1 f none opt/RCnmh/bin/mark 0755 root root 53272 21451 888679337 1 f none opt/RCnmh/bin/mhbuild 0755 root root 108956 52567 888679338 1 f none opt/RCnmh/bin/mhmail 0755 root root 39440 25828 888679339 1 f none opt/RCnmh/bin/mhn 0755 root root 137424 14117 888679340 1 f none opt/RCnmh/bin/mhparam 0755 root root 38976 57854 888679340 1 f none opt/RCnmh/bin/mhpath 0755 root root 50612 41137 888679341 1 f none opt/RCnmh/bin/msgchk 0755 root root 43188 49531 888679341 1 f none opt/RCnmh/bin/msh 0755 root root 220924 44820 888679342 1 l none opt/RCnmh/bin/next=show 1 f none opt/RCnmh/bin/packf 0755 root root 62856 53320 888679343 1 f none opt/RCnmh/bin/pick 0755 root root 84376 34265 888679344 1 l none opt/RCnmh/bin/prev=show 1 f none opt/RCnmh/bin/prompter 0755 root root 42204 15165 888679344 1 f none opt/RCnmh/bin/refile 0755 root root 57020 19182 888679345 1 f none opt/RCnmh/bin/repl 0755 root root 142640 62653 888679346 1 f none opt/RCnmh/bin/rmf 0755 root root 41068 51764 888679347 1 f none opt/RCnmh/bin/rmm 0755 root root 50832 29145 888679348 1 f none opt/RCnmh/bin/scan 0755 root root 127060 61668 888679348 1 f none opt/RCnmh/bin/send 0755 root root 75868 18741 888679349 1 f none opt/RCnmh/bin/show 0755 root root 149940 11719 888679350 1 f none opt/RCnmh/bin/sortm 0755 root root 79864 61350 888679351 1 f none opt/RCnmh/bin/whatnow 0755 root root 81584 46680 888679351 1 f none opt/RCnmh/bin/whom 0755 root root 57064 56504 888679352 1 d none opt/RCnmh/etc 0755 root root 1 f none opt/RCnmh/etc/MailAliases 0644 root root 1100 26608 888679373 1 f none opt/RCnmh/etc/components 0644 root root 26 1687 888679371 1 f none opt/RCnmh/etc/digestcomps 0644 root root 275 22959 888679371 1 f none opt/RCnmh/etc/distcomps 0644 root root 22 1869 888679371 1 f none opt/RCnmh/etc/forwcomps 0644 root root 26 1687 888679372 1 f none opt/RCnmh/etc/mhl.body 0644 root root 46 4238 888679366 1 f none opt/RCnmh/etc/mhl.digest 0644 root root 193 18216 888679366 1 f none opt/RCnmh/etc/mhl.format 0644 root root 379 35353 888679367 1 f none opt/RCnmh/etc/mhl.forward 0644 root root 284 26100 888679367 1 f none opt/RCnmh/etc/mhl.headers 0644 root root 415 37981 888679367 1 f none opt/RCnmh/etc/mhl.reply 0644 root root 122 10678 888679368 1 f none opt/RCnmh/etc/mhn.defaults 0644 root root 386 32635 888679374 1 f none opt/RCnmh/etc/mts.conf 0644 root root 786 3140 888679327 1 f none opt/RCnmh/etc/rcvdistcomps 0644 root root 104 9037 888679372 1 f none opt/RCnmh/etc/replcomps 0644 root root 556 46563 888679372 1 f none opt/RCnmh/etc/replgroupcomps 0644 root root 965 10739 888679373 1 f none opt/RCnmh/etc/scan.default 0644 root root 455 38705 888679368 1 f none opt/RCnmh/etc/scan.mailx 0644 root root 273 22785 888679368 1 f none opt/RCnmh/etc/scan.nomime 0644 root root 378 31699 888679369 1 f none opt/RCnmh/etc/scan.size 0644 root root 245 20462 888679369 1 f none opt/RCnmh/etc/scan.time 0644 root root 284 23925 888679369 1 f none opt/RCnmh/etc/scan.timely 0644 root root 404 32811 888679370 1 f none opt/RCnmh/etc/scan.unseen 0644 root root 252 21047 888679370 1 f none opt/RCnmh/etc/tmac.h 0644 root root 1183 16057 888679376 1 d none opt/RCnmh/lib 0755 root root 1 f none opt/RCnmh/lib/ap 0755 root root 110236 3482 888679355 1 f none opt/RCnmh/lib/conflict 0755 root root 46704 129 888679356 1 f none opt/RCnmh/lib/dp 0755 root root 109780 1769 888679356 1 f none opt/RCnmh/lib/fmtdump 0755 root root 99340 65152 888679357 1 f none opt/RCnmh/lib/install-mh 0755 root root 40040 43002 888679358 1 f none opt/RCnmh/lib/mhl 0755 root root 129264 43645 888679358 1 f none opt/RCnmh/lib/post 0755 root root 83464 53327 888679359 1 f none opt/RCnmh/lib/rcvdist 0755 root root 101936 37149 888679360 1 f none opt/RCnmh/lib/rcvpack 0755 root root 50420 2651 888679360 1 f none opt/RCnmh/lib/rcvstore 0755 root root 50940 47243 888679361 1 f none opt/RCnmh/lib/rcvtty 0755 root root 116236 39984 888679362 1 f none opt/RCnmh/lib/slocal 0755 root root 69324 51203 888679363 1 f none opt/RCnmh/lib/spost 0755 root root 66044 55122 888679363 1 f none opt/RCnmh/lib/viamail 0755 root root 641 48039 888679374 1 d none opt/RCnmh/man 0755 root root 1 d none opt/RCnmh/man/man1 0755 root root 1 f none opt/RCnmh/man/man1/ali.1 0644 root root 1955 38980 888679378 1 f none opt/RCnmh/man/man1/anno.1 0644 root root 1869 30464 888679378 1 f none opt/RCnmh/man/man1/burst.1 0644 root root 3713 5299 888679378 1 f none opt/RCnmh/man/man1/comp.1 0644 root root 4032 28109 888679379 1 f none opt/RCnmh/man/man1/dist.1 0644 root root 5309 13156 888679379 1 f none opt/RCnmh/man/man1/flist.1 0644 root root 4968 44233 888679379 1 f none opt/RCnmh/man/man1/folder.1 0644 root root 6968 14043 888679380 1 f none opt/RCnmh/man/man1/forw.1 0644 root root 7826 42770 888679380 1 f none opt/RCnmh/man/man1/inc.1 0644 root root 5097 60382 888679381 1 f none opt/RCnmh/man/man1/mark.1 0644 root root 5499 31067 888679381 1 f none opt/RCnmh/man/man1/mh-chart.1 0644 root root 9750 39503 888679381 1 f none opt/RCnmh/man/man1/mhbuild.1 0644 root root 18652 3749 888679382 1 f none opt/RCnmh/man/man1/mhl.1 0644 root root 9457 58040 888679383 1 f none opt/RCnmh/man/man1/mhmail.1 0644 root root 2305 3728 888679383 1 f none opt/RCnmh/man/man1/mhn.1 0644 root root 25237 56187 888679384 1 f none opt/RCnmh/man/man1/mhparam.1 0644 root root 1717 16819 888679384 1 f none opt/RCnmh/man/man1/mhpath.1 0644 root root 3060 63391 888679385 1 f none opt/RCnmh/man/man1/msgchk.1 0644 root root 1746 21356 888679385 1 f none opt/RCnmh/man/man1/msh.1 0644 root root 6568 58138 888679385 1 f none opt/RCnmh/man/man1/next.1 0644 root root 1686 14714 888679386 1 f none opt/RCnmh/man/man1/nmh.1 0644 root root 8456 28510 888679382 1 f none opt/RCnmh/man/man1/packf.1 0644 root root 1720 15681 888679386 1 f none opt/RCnmh/man/man1/pick.1 0644 root root 9396 46353 888679386 1 f none opt/RCnmh/man/man1/prev.1 0644 root root 1709 16973 888679387 1 f none opt/RCnmh/man/man1/prompter.1 0644 root root 4323 54018 888679387 1 f none opt/RCnmh/man/man1/rcvdist.1 0644 root root 1896 35502 888679387 1 f none opt/RCnmh/man/man1/rcvpack.1 0644 root root 1164 32769 888679388 1 f none opt/RCnmh/man/man1/rcvstore.1 0644 root root 3475 46656 888679388 1 f none opt/RCnmh/man/man1/rcvtty.1 0644 root root 2521 25263 888679389 1 f none opt/RCnmh/man/man1/refile.1 0644 root root 4546 9903 888679389 1 f none opt/RCnmh/man/man1/repl.1 0644 root root 11065 1620 888679389 1 f none opt/RCnmh/man/man1/rmf.1 0644 root root 2453 20620 888679390 1 f none opt/RCnmh/man/man1/rmm.1 0644 root root 1775 22712 888679390 1 f none opt/RCnmh/man/man1/scan.1 0644 root root 6035 8646 888679390 1 f none opt/RCnmh/man/man1/send.1 0644 root root 7069 36804 888679391 1 f none opt/RCnmh/man/man1/show.1 0644 root root 6194 29296 888679391 1 f none opt/RCnmh/man/man1/slocal.1 0644 root root 11731 46595 888679391 1 f none opt/RCnmh/man/man1/sortm.1 0644 root root 3357 33816 888679392 1 f none opt/RCnmh/man/man1/vmh.1 0644 root root 3409 37054 888679392 1 f none opt/RCnmh/man/man1/whatnow.1 0644 root root 4878 46130 888679392 1 f none opt/RCnmh/man/man1/whom.1 0644 root root 1943 37073 888679393 1 d none opt/RCnmh/man/man5 0755 root root 1 f none opt/RCnmh/man/man5/mh-alias.5 0644 root root 6563 47334 888679394 1 f none opt/RCnmh/man/man5/mh-draft.5 0644 root root 6371 39888 888679394 1 f none opt/RCnmh/man/man5/mh-format.5 0644 root root 17779 2925 888679395 1 f none opt/RCnmh/man/man5/mh-mail.5 0644 root root 6620 46628 888679395 1 f none opt/RCnmh/man/man5/mh-profile.5 0644 root root 19847 63233 888679396 1 f none opt/RCnmh/man/man5/mh-sequence.5 0644 root root 9127 28415 888679396 1 f none opt/RCnmh/man/man5/mh-tailor.5 0644 root root 8643 30098 888679397 1 d none opt/RCnmh/man/man8 0755 root root 1 f none opt/RCnmh/man/man8/ap.8 0644 root root 2284 1859 888679398 1 f none opt/RCnmh/man/man8/conflict.8 0644 root root 1690 15905 888679398 1 f none opt/RCnmh/man/man8/dp.8 0644 root root 1879 30491 888679398 1 f none opt/RCnmh/man/man8/fmtdump.8 0644 root root 1113 29427 888679399 1 f none opt/RCnmh/man/man8/install-mh.8 0644 root root 1818 27942 888679399 1 f none opt/RCnmh/man/man8/mh-mts.8 0644 root root 3714 65223 888679399 1 f none opt/RCnmh/man/man8/post.8 0644 root root 3738 36 888679400 1 i pkginfo 210 16214 888661423 0707010000ceee000041ed00000064000000640000000234f7e5af00000000000000200000001b00000000000000000000000800000004install0707010000cef0000081a400000064000000640000000134f82b9b000003db000000200000001b00000000000000000000001200000004install/copyright Copyright (c) 1997 Richard Coleman All rights reserved. Permission is hereby granted, without written agreement and without license or royalty fees, to use, copy, modify, and distribute this software and to distribute modified versions of this software for any purpose, provided that the above copyright notice and the following two paragraphs appear in all copies of this software. In no event shall Richard Coleman be liable to any party for direct, indirect, special, incidental, or consequential damages arising out of the use of this software and its documentation, even if Richard Coleman has been advised of the possibility of such damage. Richard Coleman specifically disclaims any warranties, including, but not limited to, the implied warranties of merchantability and fitness for a particular purpose. The software provided hereunder is on an "as is" basis, and Richard Coleman has no obligation to provide maintenance, support, updates, enhancements, or modifications. 0707010000ec61000041ed00000064000000640000000334f7e5af00000000000000200000001b00000000000000000000000600000004reloc07070100013630000041ed00000064000000640000000334f7e5b000000000000000200000001b00000000000000000000000a00000004reloc/opt0707010000c01a000041ed00000064000000640000000634f7e5b400000000000000200000001b00000000000000000000001000000004reloc/opt/RCnmh0707010000c01b000081a400000064000000640000000134f82b9b000003db000000200000001b00000000000000000000001a00000004reloc/opt/RCnmh/COPYRIGHT Copyright (c) 1997 Richard Coleman All rights reserved. Permission is hereby granted, without written agreement and without license or royalty fees, to use, copy, modify, and distribute this software and to distribute modified versions of this software for any purpose, provided that the above copyright notice and the following two paragraphs appear in all copies of this software. In no event shall Richard Coleman be liable to any party for direct, indirect, special, incidental, or consequential damages arising out of the use of this software and its documentation, even if Richard Coleman has been advised of the possibility of such damage. Richard Coleman specifically disclaims any warranties, including, but not limited to, the implied warranties of merchantability and fitness for a particular purpose. The software provided hereunder is on an "as is" basis, and Richard Coleman has no obligation to provide maintenance, support, updates, enhancements, or modifications. 0707010000cef1000041ed00000064000000640000000234f7e5b200000000000000200000001b00000000000000000000001400000004reloc/opt/RCnmh/bin0707010000cef2000081a400000064000000640000000134f82ba30000df64000000200000001b00000000000000000000001800000004reloc/opt/RCnmh/bin/aliELF( 4D4 (44  Q,,/usr/lib/ld.so.133e}kb QJ"M[awfZ;Sxtp]^%s9 iAB~C!|)=Vn*, q+  {1<hz$8KIN_ g4LHoDyEjRU/dX('WY&@2G`Pu:c?-7T0>v\Ol#rm5F.6 t$@$d(     ,  Ҹ 2l5`, \)( t0<ENX[8bpwjSl0HtP 8(t|°”< <"'4-8|>HGpO V$] ej>@Dr X@!wPT  i @\h H ¨` UL yPnT#œ,42X8ut?ILQ\cjo$$wDql(O($;h dT„R $¸T#]'H- h7>EH€QLh\djt<|@<|0w|40r(hP,h%w0L/6?xFDMD\4e?4mwQ4$,8,  T`fL.< X@dtl-ˆ5l<xHQL[\cdj@r|0Ztx$ RXT¼[´X <L@ OLLE%0.7P@@GTR4PY0^@,cGXn0t}i@0 8H˜ lŒ X`^|=`% ,?83 @GtOXapi8t H !{0lT¤s(Tt?p,$4H  M$Z d. 4y09>xG¬PPX~_kv\s{lYluucpldiraliasakerrorgetadrxmhlreply_startsigemptysetmmdfldirmts_initcontext_findcallocbuildmimeprocmfgetsvmhprocget_returnpathatoivfgetsmh_defaultsforwcompsgetcwdakaheadSIGNALdefpathsetuidfreadgetpwuidnsequencemoreprocuucplfilcatprocvfprintftoupper_environ_endshowmimeprocprint_akaismymboxpidwaitmmdlm1mmdlm2incprocforketcpath_iobrcvdistcomps__flsbuf_GLOBAL_OFFSET_TABLE_msg_stylem_eomsbrsleepctxflagssigactionSystemNameinbox__ctypesetpwentlprocabortgethostbynamecontext_readpathatooifileprocfseekmkdirsmatchsigaddsetgeteuidstrcasecmplequalatexitcontext_savebb_domainexitpidstatusstrerrorprint_versioninit_pwsigmsgversion_strdraftwhomproctoloweraccessLocalNamedigestcompsmallocmhetcdiruprfsprintfmshprocNoShelladdunamegetfolderanoyesauxformatmhlibdirprint_helpmsgprot_initmsg_countserversreplcompscomponents.umulseekadrxm_mailpathmh_profile_filbufhometailadvisem_putenvssequalgetpwentftellwritevmmdflfilpwdgetfullnamegetuidvforkmsg_delimm_maildirungetcgetpwnamfclosegetenvreplgroupcompssendmailambigswAliasFilesnprintbwaitpidsnprintfsysedcurrent_DYNAMICinvo_namestrncmpchdirm_unknownprint_usrprintf__iobexeclsetgidsetlocalermmprocfilenoSIGPROCMASKversion_numdefaultfoldercontextstrcatstrncasecmpgetgrnamdistcompsreallocgetusrstrrchrvsnprintfhostableganspsequencepostprocfdopen_exitstringdexpackprocm_readefsmhlprocadvertiseexeclpmypathenvironEveryoneperrorpophosterrnobrkstringmnfreeunlinkakresultgetgrgidr1bindexstrchrsethostentisfromfreegetmadrsprintfclosefoldprotm_Eomuucpadrxakvisiblestrcmpadiosfgetsmaildeliveryfaceproc_edata_PROCEDURE_LINKAGE_TABLE_fopenmh_seqhomeheadstrcpymhlformatmhlforwardm_getfldseek_home_etextcopyip_lib_versionfflushSIGNAL2sendprocshowprocpfolderclientname_ctypeakvalueendpwentinstallprocrcvstoreprocgetgidunputenvmainusequencegetnamermfproc__filbufchmodmemcpyadmonishstrlenakatailmkstempstatprint_swwhatnowprocgetanswer_finicopydone_cleanupmailprocfprintfgetcpysigprocmasktrimcpyctxpathisattylegal_personm_defsmakedirconcatlibsocket.so.1libnsl.so.1libc.so.1 <4 X HJZ] $m0<HTA`lx#jKfg ,8DP \ht-+(,4S@LWXTdp|}V=EG'_ $0<2HqT`Nlx M3 @D# @esi!@eo@g, @ –<"@@ed@ee㿐@/e/e  `    㿐     i@eEbx@@  /!@)$!T!T@ "?@Xibi@ ?c0@ #0@`@?#0@@ n`/J!5L -], @᠐  T* *,*@*+++++ +(+0**T@c@7  ib@Ti@db@ @' @ *T@# @ `L - i@b@" @@ ib@@       ` , ">Ц@ `0`i@""'@ibi@-i@ @" `@c@ @A`2@"@d@"쀥`  aT i@+c @ >В@`@ @  @%>@`@# @ 0!`%i3@@dVHa@@dU &a@a@ ``2@@{ 㿐 2i@d<#P0V* ? !%âh:  "4 , !N "-` i#`i@d!x#! Ci@d#h $!i@d#p! $!h $!`$h @d ``$`*@* Ȱ ahah? "ah @c  " * "a㿐@N icx@  @z !i ic@w!i@5"x != +i@b@( 0  @[  @`   @`  i#@ @ @@F@bx @=0@6< @cu㿐#a !@y"!?$"a@;"̀"$"̝́㿐`# 'iL` @$@ @d@ 㰔@  @c= @c;```2L`b̀?L "b́㿐`  ʐ@   2@1 JJ@*  (8(8"  J` J@` `* 㿈N /ic@b   ic@b  @i@bcȢ"" i#Z"b@bސ @쀢 @N ; < :6 " #@ J@ " ݐ@b0k""А@J@ $@! O뀢 : ; 0, , @N +. <  *709 =04@b< @| J@ @ @bv, @l J@ @ @a J@ @ @b[ @ {@=v@0@bK 㿐  ""bА"icbА"j`bА"j `bА"j`8j`P@b1"ȁJI   J2 㿐N#I @  J@ " *@`J@ "J@*@㿐ؐN#I @  ?Ɛ ( J @ `2 .@*&㻐@i@aɒcȠ"" $@aŔ  @@0@a 㿐@a2 ` @a@a2` "", `$` @ "& %`@@a 2`@@0`2@@a "` @@` `$` @ 2 㿐@ax  @at@au "" @"`" `2`@@``2` 㿐!T  J  @aL  "aL"  % L@$ `2  @a7T " @T  2 "@  " H <  JI " J  J2 J $ H, H,H,( ’IH" (8H㿐    @`א "  2@`Ԑ @Ð$ @`͒ @ 2 , @`ǒ !`?, $   "& $㿐bȀ """" @`"b@` @% @`㿐@`  @&. &  & " a ""a"㿐@`~  @k& &  & @d & @a & &  & " b ""b"p" " @ +  2NЀ ¢#I*`:  ``"@`I,, N  ,@`*Ѐ  㿐@¢L@ / ~`00E@` /"L`. L`  "@` 2   /.?"j j А@_̔  /.?@` ?@@_ ?"Ԑj`@_@_ ?" "@"@ `"@ 㿐 k`H@<k@Nh㿐+%c)%# '$%$#$c!$"*"Ԁ "k p@ @_"   $" $c $ $ %# "" `%cJ@ 1@_1"ԁ㿐JbԀ bԀ @_    k`x@ " ;# 7# 2# -# 2( k / /  /  /  /  /  /  /  /  / / / @/   k`# `# ` k`@_1    k`@  @  @_  ,2& k`@_ )   k@z`| @b`& @ې & !#`9 &  . "# @& c`^& $Y #   @ & @#0& @^ƒ ! "  *@ & @#& (?. @#c`& & & #  @& & #   & @@ @ & # "@}& "# & @s& $# @k& (㿐 .  " @^C  " @^= " @^7  " @^1  " $@^+ $ " (@^% ( @^@^㿐N    `"k p@^J '` ?  "k! k!(  k p k p @]  `" k @]a0`2 1?"Ԁ`2 (  "' ( ( `"k!8 @  (@]Ř""1"k!H @ @]1 "kaP@]1"@]b1"ԁ㿐`@`1@?"ԐkaX@]㻐!#  "#@r#$` k@ Ր!` $#@io$# #]     $ kax@! $J *  $ $ @][  @J *2 $* "kJ * $`$@]A@J *2k $*k@]s!L "$ k@Øaxka@]_  k4ak@ ` "   "#  ?$"@@\ @  J .@ @?   @8c$ y #`t# l@\נ @\Ӑ &c  "   L L" @  2KL@˒ "CL@ &<L 2<   "4@\@\ &* "   "   " @ Ӓ 2 @ "   @v 6  2  㿐k"@\`k@\]"k"(k@0 @ !Tk@\M"8@\K@`}k"H)k`N " `@@ t "k`@@&g``  N 2@J n2@J o2@@@\= @`` "  @2@@ 0 (/pqk "H /q /r /s /t@[/u@  @ @,`@  ), @  @,`  "P p  k"X"P@@[```@ `㿐kb"h@[㿐!#D  !"#H@[א$ $#D k@ Xbx )' #H &Na%#HD@[*` $D k@ DbN@+  . @! D.D& "@  @ 2 ` *  2: `Ǥ`" J@ @* 8(8` J@ @ J2 ? ?:J 㿐 N 2kk"k"А@ Ȗ@[53 N .  <. N $  ,?+@"N"N*N *N  N 4N  >**㿐`  ?@  2& N ?㿐 `2N@( $`¤#I    @[ @ @` `@Z߰ N@ ` 㿐!#P $"#L@Zϐ$ $#P k@ Pb#PcL @?$`@Z #P@"` &@P   J H?@Z@* J \" @ k@ cL  #P .&@@  J@ \ `?@:J@ L  ?,@ #L#Pd&#L@Z$@2 k@ b#L%#P#8 !" 2.kk@Zs# $"@Zw@Zx "   ` J@   k@ ǒc(!@ /$"!@Z""@ kJ /"*k#@@ZGkL @ #$c8k@ZcH 'dc8k@ cPL /Nc8@KÒc`"4@ "c8k@YcH ;'d@Z(`  k#hk@ vcp@Z!@Z@Z@Zkck"@Z Ð!xk@Yc@Z"@Y?@Y   #8k@YcH 'd k@ LcÐ"d4@ @Ydk@ #>lK 9 / $k@ @Y @Yh?'l" k@ ck#k@7 @b  l`@ @Y]@ 2l l`@@ l@Y XL "@@ _"bk@YNcH  'd d@ @YGd㿀'H'L'P'T'X@Y0 H` @Y'`@YD l@ Œ`h@H` @`㿐!#T  @Yg!X@Yh@ $#T#T  @b㻐)ä!Xl @X@YP!h¢#I!X? %!X@YI `$ @ ?;:!X ``",@X, ,O ?2l@X @ ˠ#l@X`  2l@u 6?l l l Ȑ @Xl      W l@ @a0fW pppp$@S,\\\]]]@X 2& l@ b(&` $` @yp$@@tpp$@e@5@T$`@XF ,``"@@Jp$`,`#X` #X@@XV "   2@ lbP lbx@Δ" 㿐`l"`l"@X@X@X. l@b@X;@X7.N@ @W㿐? '@XY `'  @` ܀ F J@ @   `7 @ 1` '% ? '@X) `'  @`܀ J@  @ 2 ``@ 2` X . @`cT`dh`` `-|` ? '@W `'  @`2` 2`,? '@Wؐ `'  @` ܀ O J@ @0   `װ @ Ұ ` 1'% ? '@W `'  @`܀ J@  @ 2 ``@ 2`@W" .       , $ , `:` ?$ # @Wd?`:., lb@?' ?'`:` % 4 ., lc@p ̰? #I @   * , , '?'  @@A  `@  &@$@ $ @ @VԔ%   ?,@W  2` "` "|  ?' `u'  ?' ` @' ܀ /`-"!"@ɖ&@"  bԑ* @"ز@@ @" @ &@  ?@Vn "@'' )" #., lb@?  &@ @VS' "'  "@''  lc(@,$"`؁㿀% $@Vp  @Vl #lcX@U   $l#` ? &@VH `&  @ ",, @VH a$ "lJ 2l#h"a$!$ "`@U@Uؐ' $* #!*"$b$ @U" b! `$"ܐ l@?cp!@Uϒ "b"ܠ  : L* "  *L`܀ / #!? &@U `&  @܀ `J  @; 2 `@ 2@U㿐 "  " * "b""" "`"! @U3$ "b "@"܁㿀@U !"@U"  b@U   ܀ 0@U @? &@@Ul% ` &`   ܀   @? &@@UW ``&` @  &,, , 㿐 @T 7 'l @T r" @Tʔ  @U<  @Tܒ "lc$@@T L@lc$@@TL@L@ "`lc @T*   " @@`(`8J (`8 (J    KJ   *K *J @ ? $  @ `  㻈@'@T!h@T@Tՠ&@T%â / @Tl /.@Tu    I@T! E.@T!퀢?Cm;@Ty?  %l#l.c@Tm!m@Tn @T`@Tmm @T m @T Ð!xm@TG`(@T`@S?@?Òahm@”   0lc@ 0m@< 8 "@ @Tl㿐    @TeL?Р  @ ?А p c@ C ?@C*c@>@TN@TN @TK @TH @TE  @>!"m@S`H"m@K`P" %mL  "  @SՒ` 2L @S @@Su 㿐@S@S ?@T ? ?@T  ?  @S@S@S@S@?h@S@S @S  @ڔА@S  @ϔ??́㿐 >  Bm@Snc mc(6 5?#1  .m@SZc mc8@SU   , @ m#Hm#Xm#h@S@0 m#pm#xm#h@S3㿐@R@R@S mc@RՖ#<   @M 2$$  ``@R*  #<    `"@   `.`"`.`""#< 㿐#<@ 2  2 2    `@ 2`@ $"@  J@=   J@J`J J=`?㿐@S P'Ԑ@RЀ 'А 'А@R ?P @R  '@RزЀ 'А 'А@R ?㿐?4?&1> @R,`)   @&   JK K  2  J "ܰ&??&:   2 㿐N#I @   N 2 @Q?@ ”#IJ@ "N*@@:J@N –#I J@ 2*@`J@ 2 @ߐ㿐@E @QJ /"*㻐N /*mc@Q  #m@Qc m@Qc mc@Q  !"@Qǒɐ@@Q0@g 㿐2L@@ L@ /mc@Qy  m@Qc m@Qc  mc@Qf  1"@Q0*"m@#mL  / bm@Q<c@QCm#@ @N? / /. @Qf1"  *㿐@ @QJ /"*㻐`2(N !m@9#Ȕ@PI@m#!m/#Д@P@&  @P@@Pސ N /`2 !mc@Pޔ  m@Pc耢 m@Pc  mc@P˔  !Y!"쀢 @$"m@Pϒc耢 m@Pɒc B"@P"" /@Q  "@"`mc@P  " m@Pc  mc@P  n`@Ps&@ @P}  2 n`@Pa&@ @|㿐N /sL@ /k`L@ ." / "`` \`@][,@ L /" @PuML@m@PUc耢  @8D,@m@PIc 2@(ߢ L@ /@@8L@@(Ԣ -,@mc@P  2( L /?8L( `mc@P  2 L@`@P+L@L@ 2L@㿐@O @P n@`@P0 @O 2. n@x`.㿐 " @"pN  @ "hN "l㿐p" " @ 2   2 㿐"@P;$   n@G`8"`"nJ@ " n@O@P+?1n ```` `*@P* 1@Os?@ (1J@ /"*@ 1"㿐'L'P'T'X @L㿐'L'P'T'X @L@ 㿐'L'P'T'Xn`h@L!"!h@O@O !T`PJ@  'P@O) 'Tn x@O$'X'\`$@$@@O$` '`N n @O$@$``$@@O $``n x@O$@$``@O  $@$n@$@@N@$```nN@ "nn @N$@$``$@@N$``n @N$@$``@O8!xP$@ @O:㿐@N `n2Jn J@ *8` J  㿐 `n 2n @NӐ@`@Nΐ  `@Nɐ@N&  㿐" @N@`@N  `@N@N& 2 㿐'P'T'X@Px ؐ@N`@O4?@O n@O `@O'?@O @N @NI?:. &@@N $. .@N3㻐a  ]"a!n@N!bUª#I)$@N ?@N, 9*@O #" @N :,,@`L@   ’#I,@`L@ 2,@!X  !X@M "  2 ǐ@ "@Mؐ@M!,"a(@M!P"aL㻐N N \¦#I`\" @,N f";  n b"6 4   \"0,  t) N% ?#,  2N, ,N 0    ¤#I @N N N @`?а? , N  ,@Mj @M@M㺈Jb *bn5"!J@ @N@M@N  @N "1@Mx1!J  n!"@Nb!@M1"㺈Jb bn"! J@ @Mߐ@MQ㻐Jb b@MY@MZ n@ "nJ 2 `n "1.""  ".  .  #.  b.  !n.  ". @M3. @Lޒ0eK"` a( *:  <2 * ," * * K  *!( K 2 K"` >" ** K  *!( "@K 2n@@Lؐ"n@Lސ"Ж J "@L˒ "@L .  1nb@L~@L1"㿐J" 1a"㿐@M;@M<@Lk@L @L㿐`@LX@LU@Ls nb@LB@LC㿐 nb@LF   nb@L?   㿐N #¢#IN@ "! N @  @L N@ @  @L , :`* : @   N `N@`?㿐b  "b N  #b@LL  L b"  @  "b @ "" 㿐!"` "" @Kǐ $$"V""$"@"L#I @ " L L 2L  !@K"""$"w @Kɒ ,2;,@KÒ 1L#I @   `L@ 2`L@ #@| L`#I @ ``J@ 2`J@  @K *@` """", "" @KZ$$$$ @KՒ @ , L` $ @KJ?*$ @6 "?,  $ ?$ $$$$   *@ ˜IJ@  "  *@` *@   **㿐 nc@K  nc@K  nc @K   nc(@J   㿐+b€`#@Jސ )" '@J⠀ %@J #@Jb !@J" "$"@J$"$b$$%"%b!"`*#n#0?"b$" """ @J $"@  !@J"""$"r "  !"@#$"J#  #!b  @r#bJcI   `"J` "  n#c8@JQ# !"@J#!#@JO?J`,`;` ,@#%""& & ""& & ""& & "Jc& c` & 㻐b@"b` ;e"*`@88L*"b" ""#nc@@J. ?!" @I$" b@"b8@?#ncX@ϐ` e#*`@XHHXX4n#x#b\Y$b@Đ?" #  KC!G@?"  #nc#b`` $bb#ncn!"!#"b$""@q " b  b00 ?u$bG$"q"n#$"#nc@IOb?#b"b$b@m?S?b"b"b@"☀?D" "   < 8 """#nc@@IX )?#o!`b`"" "#nc@@I@ ? "" "#o` @H?㿐#n!@   "cx$" 㿐#b@Ԑ 2 $b@?)?@)?#"` f#@*`@p@5   #o`8@H?㿐!#"%o""@ 4 c "7$"c`@H ?@ 2 "'$"㿐#%@v  b $b#o`@Hf?@c    b$bob $@HOb$b㿐oڐ "b #%o@>  c"ސ$"o,`@/  " cc"ǐ$"@  c@H0"$"$" o`@H?㿐,#b " b$bJcI ` `"J@  @*:   (""""  D",  b"`#"J@ )" @ ) \  (", , #"   " #"J ` ,,۠ ,נ ,b` nF#xC$@,$@)[,   `"J@ " @ " \ "0" , , "J ` , ,, #" -,   `"J@ \ @ \ ] "",, #" , "J `j , , #"q  ,Jb *: b J@@Z `J@ *: ˜cI I "J`# b  Kb  *: J@`J@ *:   ( ," #"J ` ""b?"b, "" " @G <   #"" "b   ""$"㿐J " 0 1"o@Fa0 J""`" JJ@`J@ J ` 㿐!" 2 $""@FĐ$ i$"""?? &@F `&  @`"`` "5,1,b ,b@&@&@!@Fl"$"9 ""&@? &@FА `&  @`    ` " @FÒ, , *%#bd@F$b"@$b@F4b$b?㿐@/E/E㤮 ? ???㿐㿠㿠helpversionnouserusernonormalizenormalizenolistlistnoaliasalias aliasfile -%s unknown%s [switches] aliases ...missing argument to %saliasing error in %s - %sAliasfileusage: %s -user addresses ... (you forgot the addresses)%s: %*s, , no address in "%s"bad address "%s",,./../r'<' without alias-fileunable to read '%s'error in line '%s'out of memory while on '%s'no such group as '%s'unknown error (%d)nmh-0.24 [compiled on archimedes.gregor.com at Sat Feb 28 04:28:32 EST 1998]nmh-0.24%s/%s/opt/RCnmh/etc/%syesno/opt/RCnmh/etc/mh.profile.mh_profilecurcomponentsreplcompsreplgroupcompsforwcompsdistcompsrcvdistcompsdigestcompsmhl.formatmhl.replymhl.forwarddraftInboxinboxCurrent-FolderUnseen-SequencePrevious-SequenceSequence-Negation/opt/RCnmh/lib/opt/RCnmh/etccontext.mh_sequences/opt/RCnmh/bin/mhbuild/bin/cat/opt/RCnmh/bin/refile/opt/RCnmh/bin/inc/opt/RCnmh/lib/install-mh/usr/bin/more/opt/RCnmh/bin/mhmail/opt/RCnmh/lib/mhl/opt/RCnmh/bin/msh/opt/RCnmh/bin/packf/opt/RCnmh/lib/post/opt/RCnmh/lib/rcvstore/opt/RCnmh/bin/rmf/opt/RCnmh/bin/send/opt/RCnmh/bin/mhn/opt/RCnmh/bin/whatnow/opt/RCnmh/bin/whom/usr/bin/vi/opt/RCnmh/etc/MailAliases07000644-%s ambiguous. It matches-bad address '%s' - %snull addressnull address '%s'no mailbox in addressno mailbox in address '%s'insufficient memory to represent address%s%s@%s%s%s%s!%s%s %s <%s>%s <%s>%s %s%s@%salternate-mailboxesillegal address: %sMHWDEBUGmbox="%s" host="%s" %s MBEGMENDHBEGHENDplease fix the %s: entry in your %s fileUsage: %s switches are: - Profile: %s [no] %s%s %s[no]%s %s -- %s unable to malloc array in brkstringunable to realloc array in brkstring0%o0x%xunable to allocate string storagevfgets() botch -- you lose bigHOMEno HOME envariableMHrunable to read/forkunable toinstall-mh-autounable to exec [install-mh aborted]path%s/%serror openingYour MH-directory "" doesn't exist; Create it? unable to access MH-directory "%s"unable to createMHCONTEXTunable to allocate string storage%sOptions are: %s %s: %s. unknownambiguouswhomprocwhatnowprocvmhprocshowprocshowmimeprocsendprocrmmprocrmfprocpostprocpackprocmshprocmoreprocmhlprocmailproclprocinstallprocincprocfileprocfaceprocbuildmimeprocmh-sequencescontextbug: m_readefs called but pump not primedunable to allocate profile storageno blank lines are permitted in %s%s is poorly formattedunable to allocate string storageeof encountered in field "%s"eol encountered in field "%s"field name "%s" exceeds %d bytesm_getfld() called with bogus state of %dFrom From  maildrop delimiter must be at least 2 bytesremote from%.*s!%.*s %.*s unable to create directoryforkunable to/bin/mkdirmkdir/usr/bin/mkdirunable to exec folder-protectwunable to write%s: %s SIGRTMAXSIGRTMINSIGCANCELSIGTHAWSIGFREEZESIGLWPSIGWAITINGfile size limit exceededcpu limit exceededprofile signalvirtual time alarmstopped (tty output)stopped (tty input)continuedstoppedstopped (signal)pollable event occurredurgent conditionwindow size changedpower faildeath of childuser-defined signal 2user-defined signal 1terminatedalarmbroken pipeinvalid system callsegmentation faultbus errorkilledfloating point exceptionEMT instructionIOT instructiontrace trapillegal hardware instructionquitinterrupthangup%s: exit %d signal %d (%s%s) , core dumped%s (core dumped)%s=%s./...../path%s/%s/%s%s/./...../%.*s%.*s/%sunable to allocate string storageunable to determine working directory/continuing...: Error %d, w+/opt/RCnmh/etc/mts.conf/var/mail/usr/spool/mail 0/opt/RCnmh/etc/hosts/usr/lib/sendmaillocalhost localnet/opt/RCnmh/etc/maildelivery-1noshelleveryonemaildeliverybbdomainpophostserversclientnamesendmailhostablemmailidmmdelim2mmdelim1uucplfiluucpldirmmdflfilmmdfldirsystemnamelocaldomainlocalnamermts.unknownThe Unknown User-ID (%d)SIGNATURE"%s"%s%sFrom >From ;<>.()[] AT At aT at %.*sextraneous semi-colonillegal address construct (%s) missing right-bracket (%s)nested groups not allowed (%s): .no mailbox in address, only a phrase (%s%s)junk after local@domain (%s)missing mailbox (%s)no at-sign after local-part (%s)no mailbox in local-part (%s)no sub-domain in domain-part of address (%s)%@no at-sign found for next domain in route (%s)no colon found to terminate route (%s)"%s",Ҽ  t   $d$@ 00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 h`XP@0( h 08HXhx(@P`hx0H`x08@ˆŒ˜œ ¤¨¬x´h°`¸P¼@80 x`H80 phX@(xh/tmp/snprintfXXXXXX(@Xxp` P@0  $,048<@DHPT;,<>: . @ ()\"[]@(#)SunOS 5.5.1 Generic May 1996as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2ld: (SGU) SunOS/ELF (LK-2.0 (S/I) - versioning).interp.hash.dynsym.dynstr.rela.bss.rela.plt.text.init.fini.rodata.got.dynamic.plt.data.ctors.dtors.bss.comment.shstrtab  ,   `tt$@$@$ )$d$d  3( ( }9?EM R,,[ `fҸҸmt;y۷0707010000cef3000081a400000064000000640000000134f82ba40000e3b8000000200000001b00000000000000000000001900000004reloc/opt/RCnmh/bin/annoELF+444 (44>h/usr/lib/ld.so.13-flbG.n)@,L#cZNx{g<Syeq ']t:%jCDE! &"8* (- >Vo,$r+#!~ /4`=+} )0K ^h6M1JpFYzmBRUudX$'W&*A5I_Pv;%\T2?w|[Osia9Q3k(7"H p@&&+4    H øԔԜԨ \L+4t!-ʸ6;ØB4KXXœ_=kĀy\z` 8P=\p„ZDlĠ$Ą,85> CJWX_fmĐuz5D@!@|8 ʄx\X Ę\d !DP&~DT,Č5;´AHR¨Zexl~$y(P$XTaTDD t@'Ĩ/7m@;DAhKRdZpcN$hnv|ʀMTD7t0,\P$l8|T00^D 7LäM 8l(1h9<BxH OʼXT\,hpouʈL@`P47x44,(  0UD$ <*4À:BHuRY@_e lv ļD\xhx<(,`d ithİ!7(/5Ĭ>klHĤPX \f$mt|0],Ld@\8Pt \y @ XP-3`89Upl@](KXĈaԤhH $|HPӨ4m 68 Ph 2@|`#. !5ĔAĴNUl\e, jdtĸ|Ì H4LcH8,thbPNid 0   , Ĝ % , 8 @ H< O V|L ^huucpldirtwsortmhlreply_startsigemptysetmmdfldirreadgmtimemts_initcontext_findcallocfolder_readbuildmimeprocvmhproctwscopyget_returnpathmh_defaultsatoiforwcompsgetcwdSIGNALfolder_freedefpathsetuidfreadseq_listgetpwuidnsequencetimezonemoreprocuucplfildlocaltimecatprocvfprintf_environ_endstrdupshowmimeprocpidwaitmmdlm1mmdlm2incprocforketcpath_iobrcvdistcompsreaddir__flsbuf_GLOBAL_OFFSET_TABLE_msg_stylem_eomsbrsleepctxflagssigactionSystemNameinbox__ctypelprocgethostbynamecontext_readpathatooifileprocfseekmkdirsmatchsigaddsetgeteuidstrcasecmpatexitcontext_savebb_domainexitpidstatusstrerrorprint_versionalarmcreatsigmsgversion_strdraftseq_addmsgwhomproctoloweraccessLocalNamedigestcompstw_dotwmhetcdirmallocsprintfmshprocNoShelladdunamegetfolderanoyesopendirmhlibdirprint_helpmsgprot_initmsg_countm_gmprotcpydataserversreplcompscomponents.umuldasctimedgmtimem_mailpathmh_profile_filbuflkfcloseadviseseq_addseltimelkclose.remm_scratchlkfopenm_putenvssequalm_backupftellwritevmmdflfilpwdgetfullnamegetuidvforkmsg_delimm_maildirm_convertungetcgetpwnamfclosegetenvreplgroupcompssendmailambigswAliasFilemktempwaitpidsnprintfsysedcurrent_DYNAMICrenamedtimezoneseq_savedtimeinvo_nametzsetstrncmpchdirm_unknownprintf__iobexeclsetgidsetlocaletw_ldotwrmmprocfilenoSIGPROCMASKversion_numdefaultfoldercontextstrcatstrncasecmpwritedistcompsreallocstrrchrvsnprintfgetusrhostableganspsequencepostproclkopenfdopen_exitpackprocm_readefsmhlproccontext_deladvertiseexeclpmypathenvironEveryoneperrorpophosterrnobrkstringunlinkr1bindexstrchrm_namesethostentfreeclosedlocaltimenow_timezoneclosedirfoldprotopenm_Eomstrcmpset_dotwcontext_replacefgetsadiosm_atoiseq_setcurmaildeliveryfaceproc_edata_PROCEDURE_LINKAGE_TABLE_fopendmktimedtimenowmh_seqstrcpymhlformatmhlforwardtw_motym_getfld_etextcopyip_lib_versionfflushseq_readSIGNAL2sendprocshowprocannotatepfolderclientname_ctypeinstallprocrcvstoreprocgetgiddctimeunputenvmainusequencermfproc.divchmod__filbufadmonishmemcpystrlenlinkseq_nameokmkstemplocaltimestatlseekseq_getnumprint_swwhatnowprocgetanswer_finicopydonefstatfprintfmailprocgetcpysigprocmasktrimcpyctxpathisattym_defsmakedirconcatlibsocket.so.1libnsl.so.1libc.so.16L0xY\n" ,#8CDP\hthGa(4@mLX`dup|B%V8.  +$0<)HTg`lx„,Sœ¨W´T>&I'^ ,85DrP\NhtÀÌØä @D# @e i @e@W, @ "@@d@d㿐@/d/d  `    㿐?c   ? T$@   i@d֒aP@@  /@"c"?@hiaXi@ *`?c@@ #@@`?#@@ `5K!89? T ,L -] + @  S* -`-t-. .-..--@@G  iah@#i@dax@  @7 @#@3 @  i@a@%@ `J75 31  i@a@ `M -2$@ i@a@L + @2?i @ra@ + ` @ ` X&@`@ `i@"  i"@ @d) ?`Xi" "  @Ӑ @Ԑ@d?i@;b(@2` ibH@1`   ibh@( 6?? X@@5 2 @  `? T@.@` ```$* @ " `@ @r` $` `@ ` @ @ K@)@v@p 㻐 i@c"!#@c$@c? @Y @)&@c@ J :"*@c 2 i@bJ - i@b@c  i@bL  !#i*`:  @ 2  `-"  @b L  㿐@X ?  i@b  @@F@cNh?| !@ic@@c@i@c?ci@Zc  @c8`  !i@#8@c04%iL "  " L`  L  @$ @c L 瀢 L? @? $@ @c0` $` *@b@b@@b @b ?i@cP @b @@b@b' @@bĐ@b? @bՐ icp@Ք  @bΒ? icp@ɔ 㿐@ ͢L@ / ~`00E@b /"L`. L`   @b 2   /.? i#i#@b[  /.?@b ?@!@b ? ic@bC@b ?" "@"@ `"@ 㻐%j@bi$ @bf@Fh?j@>cx㿐 jc@*j@㿐@G㷐?@ @b'@@b  㿐j@b.c` ߒ `?"  @b% @b 㷐 @Y @a@a@@a @a@A  @% @@ah?   ?@add @ @a @a߲㿐$@aے!? ?@a@aӒ@a8@?㿐@aɒ / L  jc$@aY@ai@jc@aQ/@a / L dj c.dc `.d `.d `.d `.d `.d `.d `.d `.d ` .d ` .d ` .d jcؔ$@a%@ad@aW㿐@a @a)$ @ay $ @a0@as1 耢 $  O@`d@ak & 㿐@ae  耢    2  耤 ""`@` @`ߐ 耢 @aA 㿐 耤  J@ "   @a!?" @`  2 @a& 㿈@  /2 #\ $jj@ 1 $j"j@c1 @`͐㿐  " $@` $  @` $  $ @` @`~@H@`@`h?@`l @`ː 2&  k@`& & && & & & & & @` ?"  @`@$  & $@`  k@j`0@`?` @"!L`   @`,2 k@R`0 $ & &&  `& *`% + ,Ԁ .k@`S`P ːk`X@`|   & @`v`&  &   d& "  @`Q*  &  k@``  4    $* "@  $      "@*`   "  @_Đ@㿐@? V E 4R    k@_` 2   `3 k@_` k @5 "  L  - : -` kJ`@  -W : @ 4 `*P"*`@B|B@BB\B0 k`А k`@y  ka @q  ka  ka8@f  k@`aX߰  J  @4   kax4@ & @ 2e  L - +? "` @_L! @ " L  L 2 L 2|  @ɐ 6@ @ &  @4@   4  "* @ " $ & 4^@  Y "    $@* `)"@@   $@* @ ?k@^a k@^a   k`ka@ 0,% $@*  ` `  "``"``2`#    `& @ 6 &  @4& `@ $ 4 㿀 " N@! "`J@ 2`!$ @^Ȑ    J 2`2 ` ??.2*@@*@`N@!  `."@*@" k@^ba    2j  2f?dk@^RaȀ ? "`  T R?k@^@a k@^:a   B@?k@^.aЀ  ?  "   " *  2&  "  ?k@^a؀ 2? @` 4?  " *  2  " ?㿐    k@]a k!@T 2 @f lL  @E  @]@ " N@ !L "L L 2 L :f`L`! @ 9 k@]aЀ ? "` 4J HF k@]a؀   " 9 7k@]a ." k@]|aȀ 2??$"``+`-``?"`@]L! @ " L  L 2 L ",@q?,@@ؒ` :,@ c  $ C` *@  <   "* @   2+    "* @ "!  "*   "    `&  6 &  4&   6   ? k!k!k" @?㿐k@h"J@   @ /㿐 kb@\~@\ߐ@ / @\ 1 kb("@\i1 @\㿐k"0@\gk@\d"@k"Xk@` @%#k@\T"h@\X@`}k"x)k`N " `@@ "k`@@&g``  N 2@J n2@J o2@@@\h @`` "  @2@@ 0 (/pqk "x /q /r /s /t@\ /u@  @ @,`@  ), @  @,`  " p  k""@@[```@ `㿐k`"@[ǒ@R (& $& (@&  | aK ]$k @k@[bP T!|ppp$@'= ,QQQRHRHRh@pp$@ @ݒ@ p@ @Z@[l @p@ p@M 0 kbkb@@[z@[`  a5 +k@b "+ @[Q"$% J@ -2   @@[}` 2 @Ɛ@"*@@?"     *@ &  2㿐 (@[X  $`? $  $@[M   ,@8  $ *` "   $  $ ,@Z@ZM?`$ ""`$@Zِ"`(kck@.@ 5 * @@Z -.@`@.@$"``@& 2&  &  4    $*   " $`@ @ZJ  *`8 @ *   (?J  p   ?@&  |   K  $k @u $  &  $ _ k#($ $k @_ $@2 @_D     *@ @6 @M+@ZD@ZZ?@Z:k@Tc0@Z@Z @Z @Z @Z  @ Аkc@ $@Z  $ "  @Z @ .` .`@Z.`: & 㿐@' ! "- 'k%@ 2L  ` @H` $` %!@Y  @Y@Y   , 2 㿐@!! 2 @Z   $! k@ ͒ch5!%k#@o 2  @Yݐ 4L  2  @ –  @Y@  a$ `,a ۠@Yؐ  $  k@ ch @ $@ $  ,  a$  *a㿐! 쀢 2$" @Y$ $  k@ wc (@Y   %!k@#@Y6{@2s  @i` *  )  $@* @ "X "U ` $ ΀@`% @Y ` k@ 3c`$&``쀤 ,@Ak@Xc@Y `@   $@ * @ "$@ $@ * @   `@ $@*  $@ $@ $  @l@XȒ`@Xؐ `@$  쀢` 㿐1 l@X`(01l 㿐`(?@ 㿐!  !" @X$ $  l@ `0 )'  &Na% @X*` $ l@ `XN@+  . @! .& "@  @ 2 ` *  2: `Ǥ`" J@ @* 8(8` J@ @ 㿐 @    (@Xs 2 $ $  $    $@Xf   $ ``  l` @ ,b @X,`@ "`$ l@ `U "`(2"  4 ` * 8  " *` "  $   ` *   "*  "  "  $ ` .*@$    ``  *@ $   *@* $    $ 㿐 @ n   (@W "$  $    $@Wג   $ ``  l` @ K @X,`@ "`$ l@ `> "`(2  ` * 8  " *` "  $ `   & *` *  "          * $    $ 㿐 $   $@Wq   $  ?㿐  N  l@ 0`@ l@WT`؀ &l@WN`  l@WH`耢 l@WB` l@W<` l@W6a N! @ 2 N  la@    J@ `J@ 2  J2 ? ?:J ! ! 2.ll@W<!( $ @W@W8 "   ` J@   l@ ǒa0!@ /$ !@V  @ lJ /"*l!H@WlL @ #$al@VaP 'dal@ aXL /Na@Kah $@ "al@VuaP ;'d@V`  l!pl@ vax@V!@V@V@Vlal @Vؖ #l@VUa@V @V*?@Y   !l@V@aP 'd l@ La!d$@ @V?dl@ !Ș>lK 9 / $l@ @V @VLh?'l l@ al!l@7 @b  lb @ @U@ 2l lbH@ l@V^"`L  x@@ _"al@UےaP  'd d@ @Ud㿀'H'L'P'T'X@U H` @U`@V l@ Œbp@H` @`㿐!  @U#@V"@ $   @`㻐)#l"@Un@Un#Ƞ!#? %#@V `$ @ ?;:# ``",@U, ,O ?2l@U?"@ ˠ#l@U7b  2l@u 6?l"l"l"А @Ul    ! Z m@ @`0fZ#ppp$@S,kkkm m m0@UQ 2& m@ `0&` $` @yp$@@tpp$@e@5@T$`@Tʐ ,``"@@Jp$`,`!` !@@U "   2@ m`X m`@Δ"!㿐`m `m @T@T@T m@`@T@T.N@ @Tu㿐? '@U `'  @`" F"J@ @  !`7 @ 1a '% ? '@T `'  @`℀ J@ !@ 2!``@ 2` [#t. @oroso` `-|` ? '@T `'  @`2` 2`,? '@T `'  @`" O"J@ @0  !`װ @ Ұ a 1'% ? '@T^ `'  @`℀ J@ !@ 2!``@ 2`@T@"".       , $ , `:` ?$ # @T?`:., m`@?' ?'`:` % 4 ., ma@p ̰? ! @   * , , '?'  @@A  `@  &@$@ $ @ @S%   ?,@S  2` "` "|  ?' `u'  ?' ` @'" /`- ! @ɖ&@"  `* @ @@ @" @ &@  ?@S "@'' )""#., m`@?  &@ @R' "'  "@''  ma0@,$"b㿀% $@S*  @S& #ma`@R   $m!h!? &@R `&  @ ",, @S b̀ "mJ 2m!p"b" "b@RG@R' $* #!*"$`Đ$"@R4""`! `$  m@?ax!@R˒ "`   : L* "  *Lb / #!? &@R `&  @℀ bJ !@; 2!`@ 2@Rz㿐 "! ""* "` "  "b ! @Q$""`" @"㿀@RU ! @RP Ġ  `@R   " 0@R< @? &@@R#% ` &`  "  !@? &@@R ``&` @  &,, , 㿐!Ȑ@Q 7 'm @Q r" @Q  @Q  @Qo "ma$@@Q+ L@maȔ$@@Q#L@L@ "`maȔ @Q*!Ȱ  " @@`(`8J (`8 (J    KJ   *K *J @ ? $  @ `  㻈@'@Pߐ#@QC@Q&@P% / @P /.@P    I@Qx! E.@Qp!퀢?Cm;@Q9?  %m!m.a@Q-!m@Q."@Q@Q-m"@QQ m" @QK #m@Pb0@Q @Pv?@?cm@”   0ma@ 0m@<"@  @ @P{㿐    @QL?Р  @ ?А p a C ?@C*a>@P@P @P @P @P  @>!!m@P?bP!m@KbX! %mL  "  @P/h 2L @P2 @@O 㿐@Pl@P ?@P? ?@P@  ?  @Pv@Pw@PN@Pv@?h@PS@PS @PP  @ڔА@P  @ϔ??́㿐 >  Bn@OȒa(na06 5?#1  .n@Oa(na@@O  !ȓ, @ n!Pn!`n!p@O0 n!xn!n!p@O㿐@Oy@Ov@Oǐ na@OY!   @M 2$$  ``@O*  !    `"@   `.`"`.`""! 㿐!@ 2  2 2    `@ 2`@ $"@  J@=   J@J`J J=`?㿐@OP'Ԑ@OeЀ 'А 'А@O ?P @O  '@OGЀ 'А 'А@O ?㿐?4?&1> @N`)   @&   JK K  2  J "ܰ&??&:   2 㿐N! @   N 2 @Nz?@ !J@ "N*@@:J@N ! J@ 2*@`J@ 2 @ߐ㿐@E @NMJ /"*㻐N /*na@N  #n@Nla n@Nfa na@N  ! @N$ɐ@@N0@g 㿐2L@@ L@ /na@Ni  n@N3a n@N-a  na@NV  1 Ȑ@M0* n@!nL  / `n@Ma@MАn!@ @N? / /. @MÒ1 ȁ  *㿐@ @MJ /"*㻐`2(N !n@9!Д@MyI@n!!n/!ؔ@Ml@&  @Mv@@Mb N /`2 !na@MΔ  n@Ma n@Ma  nb@M  !Y! Ȁ @$ Ȑn@Mza n@Mta耢 B @M4  Ȓ /@M}  @"`na@M  " n@MTa  nb@MM  nȒb@L&@ @Mm  2 nȒb@L&@ @|㿐N /sL@ /k`L@ ." / "`` \`@][,@ L /" @LҒML@n@Ma  @8D,@n@La 2@(ߢ L@ /@@8L@@(Ԣ -,@nb@M   2( L /?8L( `na@L  2 L@`@LL@L@ 2L@㿐@Lt @LŐ n@b@L0 @L 2. n@xb.㿐 " @ `N  @  XN  \㿐p! " @ 2   2 㿐 ̐@L$   n@Gb@ `"nJ@ " n@L@L?1n bhbh `*@K* 1@L?@ (1J@ /"*@ 1 ́㿐'L'P'T'X @L㿐'L'P'T'X @L@ 㿐'L'P'T'Xnbp@L! #@K@K #`PJ@  'P@K 'Tn"@K'X'\`$@$@@K$` '`N n"@K$@$``$@@K$``n"@K$@$``@LU  $@$n@$@@K@$```nN@ "nn"@Kr$@$``$@@Km$``n"@Kg$@$``@Kw#ؒP$@ @L*:㿐@K> `n2Jn J@ *8` J  㿐 `n"2n"@Kɐ@`@KĐ  `@K@K&  㿐" @K@`@K  `@K@K& 2 㿐'P'T'X@Px ؐ@Jb@K4?@Kn@Kb@J'?@K @Kw @J?:. &@@Kc $. .@J̐㻐c  ]"c"o@J`U!)$@J ?@J 9*@O #" @J :,,@`L@   !,@`L@ 2,@#  #@J "  2 ǐ@ "@Jq@J""b@J""b㻐N N \!`\" @,N f";  n b"6 4   \"0,  t) N% ?#,  2N, ,N 0    ! @JÒN N @`?а? , N  ,@I @JH@JF㺈Jc *co5 "J@ @J@Iߒ@J @J "1@IՐ1"J  o!#@J`"@J1#㺈Jc co "J@ @J@I㻐J`̀ `@I@J o@ "oJ 2 `o 1. ̐   .  .  #.  `.  !o.   . @I. @Ib0eK ̀` bЀ *:  <2 * ," * * K  *"Ѐ K 2 K ̀` >" ** K  *"Ѐ "@K 2o@@I5 o@I ؖ J  @I(  ̐@IG .  1o`@I@I1 ́㿐J ̀ 1a ́㿈@I@@㿐+ @IՐ" &  &  &  &  gl&  &  & & (  & (@I!@I <  (& `& (& $㿐$ @I" &  &  &  &  gl&  &  & & (  & ( (& ? & (& $㿀     c * *   #\#` #d  c!$o"(l#d@Ho㿈@H@㿐`x t @0 2 (N `2  *!=@!!=#o@DbP@H? o  c *  `cX  #\  #`#d!=#h@H# (   o ܕ* bx@H( 1o ܕ* b@H1!=㿐   @H < @H < @H <@H <` ``` ` `` 2  @    ` `2 !o"o"o"& @& @G 1!㿐$ u=?;4$$``4$$  4 $$  $?$$R?`c gl'` 2!m@H} d 2 !n@Hw! 2!m!n  `2@Hi d  @Hc! 24   `,@ ?. * . "* . "*  *`" * (`&1$$㿐  d ?@H2 c @H% d `,`` d?,`* * ?@H  , :`:`" @H  (&  `& (@"`" `" ` " `" `" `" `" ` " `$" $`(" (㿐 $ 2`$1`$ 2 $+ $`$4 ` 㿐@/F/F@ ? ???㿐㿠㿠helpversiontext bodynodatedatenoinplaceinplacecomponent field -%s unknown%s [+folder] [msgs] [switches]only one component at a time!missing argument to %sonly one body at a time!only one folder at a time!path./curunable to change directory tounable to read folder %sno messages in %sEnter component name: null component nameinvalid component name %stoo large component name %sunable to lock and openannotatewunable to create%s: %s %s: %*.*sunable to open for re-readingunable to rename %s tonmh-0.24 [compiled on archimedes.gregor.com at Sat Feb 28 04:28:32 EST 1998]nmh-0.24%s/%s/opt/RCnmh/etc/%syesno/opt/RCnmh/etc/mh.profile.mh_profilecurcomponentsreplcompsreplgroupcompsforwcompsdistcompsrcvdistcompsdigestcompsmhl.formatmhl.replymhl.forwarddraftInboxinboxCurrent-FolderUnseen-SequencePrevious-SequenceSequence-Negation/opt/RCnmh/lib/opt/RCnmh/etccontext.mh_sequences/opt/RCnmh/bin/mhbuild/bin/cat/opt/RCnmh/bin/refile/opt/RCnmh/bin/inc/opt/RCnmh/lib/install-mh/usr/bin/more/opt/RCnmh/bin/mhmail/opt/RCnmh/lib/mhl/opt/RCnmh/bin/msh/opt/RCnmh/bin/packf/opt/RCnmh/lib/post/opt/RCnmh/lib/rcvstore/opt/RCnmh/bin/rmf/opt/RCnmh/bin/send/opt/RCnmh/bin/mhn/opt/RCnmh/bin/whatnow/opt/RCnmh/bin/whom/usr/bin/vi/opt/RCnmh/etc/MailAliases07000644error writingerror reading-%s ambiguous. It matches-r%.*s%s.lock,LCK.XXXXXX%.*s,LCK.XXXXXX%s%s,%.*s%s%sunable to allocate folder storageunable to allocate storage@,unable to allocate storage for msgstatsnewallfirst-lastillegal argument delimiter: `%c'(0%o)no %s messagemessage %s doesn't existmessage %s out of range 1-%dbad message list %sfolder full, no %s messageno messages match specificationno messages in range %scur.message %d doesn't existfirstlastprevnextcur:sequence %s %sfullemptymsg-protect%sXXXXXX%.*s%sUsage: %s switches are: - Profile: %s [no] %s%s %s[no]%s %s -- %s %s/%srno blank lines are permitted in %s%s is poorly formattedatr- %s/%satr-%s-%swunable to write%s: %s bug: context_del(key="%s")unable to allocate profile storagebug: context_replace(key="%s",value="%s")unable to malloc storage in seq_list%sunable to realloc storage in seq_list-%s?%dunable to malloc array in brkstringunable to realloc array in brkstringonly %d sequences allowed (no room for %s)!strdup failedempty sequence namenewallfirstlastprevnextillegal sequence name: %sHOMEno HOME envariableMHrunable to read/forkunable toinstall-mh-autounable to exec [install-mh aborted]path%s/%serror openingYour MH-directory "" doesn't exist; Create it? unable to access MH-directory "%s"unable to createMHCONTEXTunable to allocate string storage%sOptions are: %s %s: %s. unknownambiguouswhomprocwhatnowprocvmhprocshowprocshowmimeprocsendprocrmmprocrmfprocpostprocpackprocmshprocmoreprocmhlprocmailproclprocinstallprocincprocfileprocfaceprocbuildmimeprocmh-sequencescontextbug: m_readefs called but pump not primedunable to allocate profile storageno blank lines are permitted in %s%s is poorly formattedunable to allocate string storageeof encountered in field "%s"eol encountered in field "%s"field name "%s" exceeds %d bytesm_getfld() called with bogus state of %dFrom From  maildrop delimiter must be at least 2 bytesremote from%.*s!%.*s %.*s unable to create directoryforkunable to/bin/mkdirmkdir/usr/bin/mkdirunable to exec folder-protectwunable to write%s: %s SIGRTMAXSIGRTMINSIGCANCELSIGTHAWSIGFREEZESIGLWPSIGWAITINGfile size limit exceededcpu limit exceededprofile signalvirtual time alarmstopped (tty output)stopped (tty input)continuedstoppedstopped (signal)pollable event occurredurgent conditionwindow size changedpower faildeath of childuser-defined signal 2user-defined signal 1terminatedalarmbroken pipeinvalid system callsegmentation faultbus errorkilledfloating point exceptionEMT instructionIOT instructiontrace trapillegal hardware instructionquitinterrupthangup%s: exit %d signal %d (%s%s) , core dumped%s (core dumped)%s=%s./...../path%s/%s/%s%s/./...../%.*s%.*s/%sunable to allocate string storageunable to determine working directory/continuing...: Error %d, w+/opt/RCnmh/etc/mts.conf/var/mail/usr/spool/mail 0/opt/RCnmh/etc/hosts/usr/lib/sendmaillocalhost localnet/opt/RCnmh/etc/maildelivery-1noshelleveryonemaildeliverybbdomainpophostserversclientnamesendmailhostablemmailidmmdelim2mmdelim1uucplfiluucpldirmmdflfilmmdfldirsystemnamelocaldomainlocalnamermts.unknownThe Unknown User-ID (%d)SIGNATURE"%s"DecNovOctSepAugJulJunMayAprMarFebJanSatFriThuWedTueMonSunSaturdayFridayThursdayWednesdayTuesdayMondaySundayPDTPSTMDTMSTCDTCSTEDTESTBSTGMT%.3s %.3s %02d %02d:%02d:%02d %.4d %s%02d %s %0*d %02d:%02d:%02d%s%s, %s%s (%s)%s%02d%02d-+ԜԘ e t  @  p H8&&h 00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0@8(  @PXhx 0H`p 8Ph8P(8X`x|ĀĈČĐĔĘĜĤpĠhĨXĬHİ@ĸ8ļ( hP@8(xp`H0p/tmp/snprintfXXXXXX0H`ʬxʰhʴXʸHʼ8(H@80( xph`XP @(#)SunOS 5.5.1 Generic May 1996as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2ld: (SGU) SunOS/ELF (LK-2.0 (S/I) - versioning).interp.hash.dynsym.dynstr.rela.bss.rela.plt.text.init.fini.rodata.got.dynamic.plt.data.ctors.dtors.bss.comment.shstrtab    p p@@ &&0 )&&8  3+4+4y9?EM R[HHl `øøfԔԔmԜԜtԨԨ(dyԤ e 0707010000cef4000081a400000064000000640000000134f82ba40000d3ac000000200000001b00000000000000000000001a00000004reloc/opt/RCnmh/bin/burstELF&H4Ќ4 (44EEHH<TT/usr/lib/ld.so.1 <B E)3+y#a}$~ok]KfXdLct|  4u1C>P&*Ml2j'"67Vn`?;qxz bv8w/g0{e!,IJ@[_s\mYD:9TiO-=pFAhZWQrG %S.5(NHRU^ "|"&H<P h H T  ĸ d&Ht&/8XEpL5XfnuH}8P@P5xpPTW  ` '4{@<CJRW3<D_@!dXqyH sp4\p _ ,Py,T &.9@y$MW(\{(fLoK$}l\<,\lL h(|h  T#Hh.6<<FGhDOU]HgDrx<0YDG|h4X<,x, L:$0-4;LJS44[elt,}@T P@D dp|@D@~t'.px:TDLT^Hdendts}p4fTR\Ph8TXLH_h@!$(W08/:X?|ENWt@] cjSXPzH8OlWh( `hhE 48h #K$,P4=FxNY !`ly8}' |4^08d`]PHd|dP 0p'/6(BJH8PPXXt_\fw4ncuucpldirmhlreply_startsigemptysetmmdfldirmts_initcontext_findcallocfolder_readbuildmimeprocvmhprocget_returnpathmh_defaultsatoiforwcompsgetcwdSIGNALfolder_freedefpathsetuidfreadseq_listseq_setprevgetpwuidnsequencemoreprocuucplfilcatprocvfprintf_environ_endstrdupshowmimeprocpidwaitmmdlm1mmdlm2incprocforketcpath_iobrcvdistcompsreaddir_GLOBAL_OFFSET_TABLE_msg_stylem_eomsbrsleepctxflagssigactionSystemNameinbox__ctypelprocgethostbynamecontext_readpathatooifileprocfseekmkdirsmatchsigaddsetgeteuidstrcasecmpatexitcontext_savebb_domainexitpidstatusstrerrorprint_versionsigmsgversion_strdraftseq_addmsgwhomproctoloweraccessLocalNamedigestcompsmhetcdirmallocsprintfmshprocNoShelladdunamegetfolderanoyesopendirmhlibdirprint_helpmsgprot_initmsg_countm_gmprotfputcserversreplcompscomponents.umulm_mailpathmh_profile_filbufadviseseq_addselm_scratchm_putenvssequalm_backupftellwritevmmdflfilpwdgetfullnamegetuidvforkmsg_delimm_maildirm_convertungetcgetpwnamfclosegetenvreplgroupcompssendmailambigswAliasFilemktempwaitpidsnprintfsysedcurrent_DYNAMICrenameseq_saveinvo_namestrncmpchdirm_unknownprintf__iobexeclsetgidsetlocalermmprocfilenoSIGPROCMASKversion_numdefaultfoldercontextstrcatstrncasecmpdistcompsreallocstrrchrvsnprintfgetusrhostableganspsequencepostprocfdopen_exitpackprocm_readefsmhlproccontext_deladvertiseexeclpmypathenvironEveryoneperrorpophostfolder_reallocerrnobrkstringunlinkr1bindexstrchrm_namesethostentfreecloseclosedirfoldprotm_Eomfgetcstrcmpcontext_replacefgetsadiosm_atoiseq_setcurmaildeliveryfaceproc_edata_PROCEDURE_LINKAGE_TABLE_fopenmh_seqstrcpymhlformatmhlforwardm_getfld_etextcopyip_lib_versionfflushseq_readSIGNAL2sendprocshowprocpfolderclientname_ctypeinstallprocrcvstoreprocgetgidunputenvmainusequencermfprocchmod__filbufadmonishmemcpystrlenseq_nameokmkstempstatseq_getnumprint_swwhatnowprocgetanswer_finicopydonefstatmailprocfprintfgetcpysigprocmasktrimcpypeekcctxpathisattym_defsmakedirconcatlibsocket.so.1libnsl.so.1libc.so.11FS(V4@LeXdp|M s$0<`HTl`ldx=!P3 +,8DP'\ht _z(QNw9A(4C@#LXXdp|0iH @D# @be#P@b@0, @ "@@b@b㿐@/b/bሮ  `    㿐?c      e@b~c@@ /@"c "?@aece@ #?c@9 #@@2`?#@@ e`-J 83? XL -> + @Ȑ  4* (`(t((((((((@@A  ec@c e@b.c@ @1 @c @- &$ "   ` L + @2, f @`@ + ` @ ` "@ `f@ (  f 0@ @a ?`Xf 8"  @ @@a?f@T`@@?`T $ f``@G    f`@= @-?? X@@ 2`@ `@ -?T@ 7#@a 2 f@`   @ @ f @`$@`* @ "/@@[` f e#@aT@@@ 2@  f`@@f@ڒa@ `@$@@aV!x@ Ғ ? T@ @ 0  T@`!? @ !? T@@@>@:@@6 㻐%@a6@ f@a2a0 f@a8   $@a$  O 2 ` @a ` A@a % $@a  @a     @  ?@`@``? @"` `  ?"` ` @`Ԑ#@`ސ?@ 4f@`ɒa0f@0a8@`А@`ђh?| !@-``  @ 2& f@aP&``$``@ $`@$` ><`@ @`@ @```$* @ "%`f!x@`u@`?2`fa@``$$* *`" ``$* "@` $`ʦ``&@*  "@`j l@ @`[e#c @Ơ@`R` f!@`-f@`.aඒf@a@`@,@`& @<#@ @`!@@` @` ?2fa@{@`?2fa@n` `$&@* *`" ` $`@_㿐 @_?+ ) %`" `` ? ? -  "      @  -@_Ғ@_ϒӸ?   2` f@b` f@b㿐@ L@ / ~`00E@_ /"L`. L`   P@_ 2   /.? f"f"@_W  /.?@_ ?@n@_ ? Ȑfb@_?@_x ?" "@"@ `"@ 㿐 gb@g@ 㿈@  /2 #\ Ȓ$g(g0@p 1 Ȓ$g8"g@db01 @_8㿐  " $@^ $  @^ $  $ @^ @^@@_@_h?@^ΐ @_ 2&  g@?bH& & && & & & & & @^ ?"  @^@$  & $@^  g@bp@^?` @9"!L`   @^ޓ,2 g@bp $ & &&  `& *`% + ,Ԁ .g@^b ːgb@^~   & @^`&  &   d& "  @^*  &  g@Œb  4    $* "@  $      "@*`   "  @^&@㿐` gb@4 gb@@  gc(@  6  gch@x @2  P @& @^2* !   " "* *`$  $ @] &  &`@^*` &  g@8c" &   &   "* "@&        "* "@ $ 㿐@? V E 4R    g@]ߒcЀ 2   `3 g@]ђc؀ g#@5 "  L  - : -`̐ gJc@Җ  -W : @ 4 `*O 0*`@<@Y-  `\5 +h@"b@ "+ @Y"$% J@ -2   @@YV` 2 @@"*@@?"     *@ &  2㿐!@@Y1  $`? $  $@Y&   ,@8  $ *` "   $  $ ,@X@XM?`$ ""`$@X"`(hbHh@OP@ 5 * @@Xɒ -.@`@.@$"``@& 2&  &  4    $*   " $`@ @XfJ  *`8 @ *   (?J  p   ?@& !   K  $h @X $  &  $ _ h"p$ $h @` $@2 @_D     *@ @6 @M+@X @X3?@Xh@ubx@XJ@XJ @XG @XD @XA  @ :Аhb $@X:  $ "  @W @ &.` .`@W.`: & 㿐@H  \ "- 'h%@Β 2L  ` @(␀` $` % \@W  @W@W   , 2 㿐@! \ 2 @W  $ \ h@ b5 \%h#@ 2  @W 4L  2  ؔ@   @WS@ 9 `$ `,` ۠@W  $  h@ b @ #$@ $  ,  `$  *`㿐!" 2$""@Wh$ $" h@ c!@@Wi   %!h@#0@W{@'2s  @i` *  )  $@* @ "X "U b"$ ΀@b%"@W- b h@ Tc8b$&bb ,@Ah@VÒc0@VА `@   $@ * @ "$@ $@ * @   `@ $@*  $@ $@ $  @h@Vc`@V `@$ "` 㿐1 Аh@Vcp01h#h㿐a@?@  㿐@ ! @ Shcxh@ ?@u   @VU㿐!"  !"" @V$ $" h@ c )' " &Na%" @V*` $ h@ cN@+  . @! .& "@  @ 2 ` *  2: `Ǥ`" J@ @* 8(8` J@ @ 㿐 @   !@@V+ 2 $ $  $    $@V   $ ``  hcؔ @ ,b @V$,`@ "`$ i@ `U "`(2"  4 ` * 8  " *` "  $   ` *   "*  "  "  $ ` .*@$    ``  *@ $   *@* $    $ 㿐 @ n  !@@U "$  $    $@U   $ ``  hcؔ @ K @U,`@ "`$ i@ `> "`(2  ` * 8  " *` "  $ `   & *` *  "          * $    $ 㿐 $   $@U)   $  ?㿐  N  i@ 0`@ i@U `0 &i@U`8  i@U`@ i@T`H i@T`P i@T`X N! @ 2 N  i``@    J@ `J@ 2  J2 ? ?:J  ! P 2.ii@TА $ P@T@T "   ` J@   i@ ǒ`!@ /$ P!@TO P P@ iJ /"*i @TiL @ #$`i@T6` 'd`i@ `L /N`@K` P<@ "`i@T` ;'d@T|`  i i@ v`@Tp!@Tq@T<@Tpi`i!@Tl #0i@TO`@Th!@Sِ?@Y    i@S` 'd i@ La \d<@ @Sdi@ ! >iK 9 / $iP@ (@SՒ @Sh?'i T i@ a0i!@iX@7 @b  iax@ @S@ 2i ia@ i@S!L !@@ _"`Xi@S`  'd d@ @Sd㿀'H'L'P'T'X@Si H` @S``@S i@ ŒaȐ@H` @`㿐!"  @SO#@S@ $""  @a 㻐)#i!@S @S# !#? %#@Sg `$ @ ?;:# ``",@S, ,O ?2i@R!@ ˠ#i@Rb  2i@u 6?i"i" i"( @Rђi    "̀ Y i@ @cX0fY"̦ppp$@S,fffggh@R 2& i@ c&` $` @yp$@@tpp$@e@5@T$`@Ry ,``"@@Jp$`,`"` "@@R "   2@ ic ic@Δ""́㿐`i#`i#@RM@RJ@R i@c@R@R.N@ @R$㿐? '@Rw `'  @`# F#J@ @  "Ѐ`7 @ 1bЀ '% ? '@RG `'  @`㔀 J@ "А@ 2"Ѐ``@ 2` Z"\. @jpmjpnjp` `-|` ? '@R  `'  @`2` 2`,? '@Q `'  @`# O#J@ @0  "Ѐ`װ @ Ұ bЀ 1'% ? '@QŐ `'  @`㔀 J@ "А@ 2"Ѐ``@ 2`@Q"#.       , $ , `:` ?$ # @Q?`:., j` @?' ?'`:` % 4 ., j``@p ̰? ! @   * , , '?'  @@A  `@  &@$@ $ @ @QX%   ?,@QP  2` "` "|  ?' `u'  ?' ` @'# /`- ! @ɖ&@"  `Б* @ Բ@@ @" @ &@  ?@P "@'' )"##., j`@@?  &@ @Pה' "'  "@''  j`@,$"c㿀% $@P  @P #j`@P1   $j "? &@Pf `&  @ ",, @P c܀ "jJ 2j "c# "c@O@P)' $* #!*"ܐ$`$#@O"#`! `$ ؐ j@?`А!@Oƒ "` ؠ  : L* "  *Lc / #!? &@O `&  @㔀 cJ "А@; 2"Ѐ`@ 2@Oޒ㿐 "" "#* "` "  "c ! @Ol$#"`# @"؁㿀@O ! @O   `@OY  # 0@OI @? &@@O% ` &`  #  "@? &@@Ou ``&` @  &,, , 㿐"ؐ@O3 7 'j @O* r" @O   @O  @O "ja$@@Nښ L@ja $@@NҖL@L@ "`ja  @NƖ*"ذ  " @@`(`8J (`8 (J    KJ   *K *J @ ? $  @ `  㻈@'@O# @N@O &@N% / @N /.@N   T I@O ! E.@O!퀢?Cj;@N?  %j!Hj.aP@N!j@N !p@N@Nj!`@N j!x@Nܖ #0j@Na@N@N%?@?c j@”p   0ja(@ 0j@<! !@ @N9㿐    @NL?Р  @ ?А p ` C ?@C*`>@NN@NN @NK @NH @NE  @>! Xj@Ma Xj@Ka \ %jL  "  @N) 2L @MՐ @@M 㿐@M@NI ?@NN? ?@NI  ?  @N @N @M@N @?h@M@M @M  @ڔА@N$  @ϔ??́㿐 >  Bk@M’`k`6 5?#1  .k@M`k`@M  "ؓ, @ k k k @M0 k k k Ȑ@M㿐@M%@M"@MX k`@M    @M 2$$  ``@M<*       `"@   `.`"`.`""  㿐 @ 2  2 2    `@ 2`@ $"@  J@=   J@J`J J=`?㿐@MNP'Ԑ@LЀ 'А 'А@MA ?P @M5  '@LزЀ 'А 'А@M# ?㿐?4?&1> @Le`)   @&   JK K  2  J "ܰ&??&:   2 㿐N! @   N 2 @L&?@ !J@ "N*@@:J@N ! J@ 2*@`J@ 2 @ߐ㿐@E @KJ /"*㻐N /*k`@K  #k@L$a k@La ka@Kޔ  ! @Kɐ@@Kڒ0@g 㿐2L@@ L@ /k`@K  k@Ka k@Ka  ka@K  1 @K0* k@!kL  / `Pk@Koa @K|k @ @N? / /. @K1   *㿐@ @KPJ /"*㻐`2(N !k@9!(@K(I@k!8!k/!0@K@&  @K"@@K N /`2 !ka@@K  k@KPaH k@KJaP  kaX@K   !Y! 耢 @$ k@K2aH k@K,a@ B @J   /@Kk  @"`ka@@Jڔ  " k@K aP  kaX@K  ka`@J&@ @J  2 kah@J&@ @|㿐N /sL@ /k`L@ ." / "`` \`@][,@ L /" @JML@k@JaH  @8D,@k@JaP 2@(ߢ L@ /@@8L@@(Ԣ -,@kaX@J[  2( L /?8L( `ka@@JB  2 L@`@JFL@L@ 2L@㿐@J  @JV k@ap@J0 @JH 2. k@xap.㿐 " @!xN  @ !pN !t㿐p \ " @ 2   2 㿐 @J}$   k@Ga P`"kJ@ " k@I֐@I?1k aa `*@I* 1@I?@ (1J@ /"*@ 1 㿐'L'P'T'X @L㿐'L'P'T'X @L@ 㿐'L'P'T'XkaȔ@L! T# @I@I # `PJ@  'P@Ib 'Tk!@I]'X'\`$@$@@IR$` '`N k!@IG$@$``$@@IB$``k!@I<$@$``@I  $@$k@$@@I+@$```kN@ "kk!@I$@$``$@@I$``k"@I$@$``@I #0P$@ @I:㿐@H `k2Jk J@ *8` J  㿐 `k"2k"@I]@`@IX  `@IS@IP&  㿐" @IB@`@I=  `@I8@I5& 2 㿐'P'T'X@Px ؐ@Hc@IM4?@Hk@IEb@IC'?@IA @H @H?:. &@@H $. .@Ho㻐`  ]"`#k@HTcU!)$@HM ?@Hh 9*@O #" @H[ :,,@`L@   !,@`L@ 2,@    @H` "  2 ǐ@ "@H@HM#"c@HH "`㻐N N \!`\" @,N f";  n b"6 4   \"0,  t) N% ?#,  2N, ,N 0    ! @HTN N @`?а? , N  ,@G @Gِ@H㺈J` *`k5##J@ @HK@G@HI @HJ "1@G1#J  l! @H<`#@H91 㺈J` `k##J@ @H@Gl㻐J`쀢 `@G@G l@ "lJ 2 `l 1.     .  .  #.  `.  !l.   . @G`. @G0eK 쀢` c *:  <2 * ," * * K  *# K 2 K 쀢` >" ** K  *# "@K 2l@@F l@G; 0 J  @F  @F .  1l`@@F@FՒ1 㿐J 쀢 1a 㿐@/F/Fl ? ???㿐㿠㿠helpversionnoverboseverbosenoquietquietnoinplaceinplace -%s unknown %s [+folder] [msgs] [switches]only one folder at a time!path./curunable to change directory tounable to read folder %sno messages in %sunable to allocate burst storage%d message%s exploded from digest %d smessage %d not in digest formatburst() botch -- you lose bigrunable to read messageunable to allocate folder storagemessage %d becomes message %d unable to rename %s tomessage %d of digest %d becomes message %d wunable to write messageerror readingerror writingnmh-0.24 [compiled on archimedes.gregor.com at Sat Feb 28 04:28:32 EST 1998]nmh-0.24%s/%s/opt/RCnmh/etc/%syesno/opt/RCnmh/etc/mh.profile.mh_profilecurcomponentsreplcompsreplgroupcompsforwcompsdistcompsrcvdistcompsdigestcompsmhl.formatmhl.replymhl.forwarddraftInboxinboxCurrent-FolderUnseen-SequencePrevious-SequenceSequence-Negation/opt/RCnmh/lib/opt/RCnmh/etccontext.mh_sequences/opt/RCnmh/bin/mhbuild/bin/cat/opt/RCnmh/bin/refile/opt/RCnmh/bin/inc/opt/RCnmh/lib/install-mh/usr/bin/more/opt/RCnmh/bin/mhmail/opt/RCnmh/lib/mhl/opt/RCnmh/bin/msh/opt/RCnmh/bin/packf/opt/RCnmh/lib/post/opt/RCnmh/lib/rcvstore/opt/RCnmh/bin/rmf/opt/RCnmh/bin/send/opt/RCnmh/bin/mhn/opt/RCnmh/bin/whatnow/opt/RCnmh/bin/whom/usr/bin/vi/opt/RCnmh/etc/MailAliases07000644-%s ambiguous. It matches-%s%s,%.*s%s%sunable to allocate folder storageunable to allocate storage@,unable to allocate storage for msgstatsBUG: called folder_realloc with lo (%d) < 1BUG: called folder_realloc with hi (%d) < 1BUG: called folder_realloc with lo (%d) > mp->lowmsg (%d)BUG: called folder_realloc with hi (%d) < mp->hghmsg (%d)unable to reallocate message storagenewallfirst-lastillegal argument delimiter: `%c'(0%o)no %s messagemessage %s doesn't existmessage %s out of range 1-%dbad message list %sfolder full, no %s messageno messages match specificationno messages in range %scur.message %d doesn't existfirstlastprevnextcur:sequence %s %sfullemptymsg-protect%sXXXXXX%.*s%sUsage: %s switches are: - Profile: %s [no] %s%s %s[no]%s %s -- %s %s/%srno blank lines are permitted in %s%s is poorly formattedatr- %s/%satr-%s-%swunable to write%s: %s bug: context_del(key="%s")unable to allocate profile storagebug: context_replace(key="%s",value="%s")unable to malloc storage in seq_list%sunable to realloc storage in seq_list-%s?%d unable to malloc array in brkstringunable to realloc array in brkstringonly %d sequences allowed (no room for %s)!strdup failedempty sequence namenewallfirstlastprevnextillegal sequence name: %sHOMEno HOME envariableMHrunable to read/forkunable toinstall-mh-autounable to exec [install-mh aborted]path%s/%serror openingYour MH-directory "" doesn't exist; Create it? unable to access MH-directory "%s"unable to createMHCONTEXTunable to allocate string storage%sOptions are: %s %s: %s. unknownambiguouswhomprocwhatnowprocvmhprocshowprocshowmimeprocsendprocrmmprocrmfprocpostprocpackprocmshprocmoreprocmhlprocmailproclprocinstallprocincprocfileprocfaceprocbuildmimeprocmh-sequencescontextbug: m_readefs called but pump not primedunable to allocate profile storageno blank lines are permitted in %s%s is poorly formattedunable to allocate string storageeof encountered in field "%s"eol encountered in field "%s"field name "%s" exceeds %d bytesm_getfld() called with bogus state of %dFrom From  maildrop delimiter must be at least 2 bytesremote from%.*s!%.*s %.*s unable to create directoryforkunable to/bin/mkdirmkdir/usr/bin/mkdirunable to exec folder-protectwunable to write%s: %s SIGRTMAXSIGRTMINSIGCANCELSIGTHAWSIGFREEZESIGLWPSIGWAITINGfile size limit exceededcpu limit exceededprofile signalvirtual time alarmstopped (tty output)stopped (tty input)continuedstoppedstopped (signal)pollable event occurredurgent conditionwindow size changedpower faildeath of childuser-defined signal 2user-defined signal 1terminatedalarmbroken pipeinvalid system callsegmentation faultbus errorkilledfloating point exceptionEMT instructionIOT instructiontrace trapillegal hardware instructionquitinterrupthangup%s: exit %d signal %d (%s%s) , core dumped%s (core dumped)%s=%s./...../path%s/%s/%s%s/./...../%.*s%.*s/%sunable to allocate string storageunable to determine working directory/continuing...: Error %d, w+/opt/RCnmh/etc/mts.conf/var/mail/usr/spool/mail 0/opt/RCnmh/etc/hosts/usr/lib/sendmaillocalhost localnet/opt/RCnmh/etc/maildelivery-1noshelleveryonemaildeliverybbdomainpophostserversclientnamesendmailhostablemmailidmmdelim2mmdelim1uucplfiluucpldirmmdflfilmmdfldirsystemnamelocaldomainlocalnamermts.unknownThe Unknown User-ID (%d)SIGNATURE"%s"Tļu < P   ""| 00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 xp------- p 0@P`p 0HXp0H`xP@0 p`XH8xh`@0 hP@0p`H(/tmp/snprintfXXXXXX 888@8P8``hp888p`XH8(  @(#)SunOS 5.5.1 Generic May 1996as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2ld: (SGU) SunOS/ELF (LK-2.0 (S/I) - versioning).interp.hash.dynsym.dynstr.rela.bss.rela.plt.text.init.fini.rodata.got.dynamic.plt.data.ctors.dtors.bss.comment.shstrtab (   "|"|$ )""  3&H&Hp9<<?PPEhhMHH RTT[ `fĸĸmt'y 80707010000cef5000081a400000064000000640000000134f82ba500015278000000200000001b00000000000000000000001900000004reloc/opt/RCnmh/bin/compELF0t4OX4 (44''''M''/usr/lib/ld.so.1aR:!1^%-QJQ$pCA!}(E0+ <NL;wF[ CJm&KAB4?>{/8+=.h1X.""~6E@lvO#I:a37e87)BKL-uHTHDg * G?2M#|0,rP OfP& DNz) %*'3ZM`GU$FYtkW5(bo;qRxSsd/<6,c\>4I@j9Vni=2_9y5']  ++0t  ' ' (h -X@@@6 0\80p#0tt*,1*=6F)K-<R`[<Xh,Lo{00\Ϡ)0D0\,XP8pr,,@x`+0/"/*tp2u;0D6M<X0`,irruw+~0՘660*`*0{Dt8@!0d++' 6 )r !,+0\60|<r( D0J-X eބPjӄTp0y*l,d(*,X0($7 ( (,$+t)(50$ 0x/$0-+5:+8ApK0hW? _*f0o@t(|0)7€,h0,+00h16(Dt70T0P*,|P$**20=0HH,4P8TYp0`Dk*TpLx-H}*0llHh*<,68*$,+)6Lt,(+,(*/)460XE*J6S/Z44b1l+\s,{,,00L' )0DL<t4-$+()t8@,p,(@ 0*<+0(70E0M- Tx`)f0`p+xd+PX68t00h*0(00T *ux r7)|$7,;u|ALK)R@[+ b8i,t)z+( ) u+1(`@)X(P8*H[l8(70&@-(h G* MU($^0e)dl:u(|0l0t?4|00' }8 )L٨00q(|0 7 r( ! }H 0 '0 4+ ; BP K0 R1L h W0 a4 k0 s-0 x*x ~+D / 4 +h )@ 0  ) 8 , - ) * P  0 d  T0 pD + )p $0 ->$ 5P <, H P* Xu `, g0 nu uь } uucpldirtwsortm_tmpfilmhlreply_startrefilesigemptysetmmdfldirreadgmtimemts_initcontext_findcallocfolder_readbuildmimeprocvmhproctwscopyget_returnpathatoimh_defaultsforwcompsgetcwdSIGNALfolder_freedefpathsetuidfreadseq_listseq_setprevgetpwuidnsequencedebugswsplitswdistouttimezonemoreprocuucplfildlocaltimecatprocvfprintf_environ_endstrdupshowmimeprocpidwaitmmdlm1mmdlm2incprocgetpidforkdistfileetcpath_iobrcvdistcompsreaddir__flsbuf_GLOBAL_OFFSET_TABLE_msg_stylem_eomsbrsleepctxflagssigactionSystemNameinbox__ctypelprocgethostbynamecontext_readpathatooifileprocfseekmkdirsmatchsigaddsetgeteuidstrcasecmpatexitcontext_savebb_domainexitpidstatusstrerrorprint_versionalarmcreatsigmsgversion_strdraftseq_addmsgforwswwhomproctolowerpushaccessLocalNamedigestcompstw_dotwmallocmhetcdiruprfsprintfmshprocsymlinkNoShelladdunamegetfolderanoyesopendirmhlibdirprint_helpmsgprot_initmsg_countm_gmprotcpydataserversreplcompscomponentsdup.umuldasctimefputsdgmtimem_mailpathmh_profile_filbuflkfcloseadviseseq_addseltimelkclose.remsetjmpm_scratchlkfopenm_putenvssequalm_backupftellwritevmmdflfilshowfilepwdsscanfgetfullnamegetuidvforkmsg_delimm_maildirm_convertgetansungetcgetpwnamfclosegetenvreplgroupcompsdup2sendmailpushswambigswAliasFilemktempwaitpidsnprintfsysedcurrent_DYNAMICrenamedtimezoneseq_savedtimeinvo_nametzsetstrncmpchdirm_unknownprintf__iobexeclsetgidsetlocaletw_ldotwrmmprocfilenoSIGPROCMASKversion_numdefaultfoldercontextstrcatstrncasecmpwritedistcompsreallocgetusrstrrchrvsnprintfhostableganspsequencepostproclkopenfdopenunique_exitpackprocm_readefsmhlproccontext_deladvertiseexeclpmypathenvironEveryoneperrorpophostfolder_reallocerrnobrkstringunlinkr1bindexstrchrm_namesethostentlstatfreopenfreem_draftclosedlocaltimenow_timezoneclosedirfoldprotopenm_Eomstrcmpset_dotwcontext_replaceadiosfgetssendsbrm_atoiseq_setcurmaildeliveryfaceproc_edata_PROCEDURE_LINKAGE_TABLE_fopendmktimedtimenowmh_seqexecvpwhat_nowstrcpymhlformatmhlforwardtw_motyclosefdsm_getfld_etextcopyip_lib_versionfflushseq_readSIGNAL2sendprocshowprocannotatepfolderclientname_ctypecpydgstinstallprocrcvstoreprocgetgiddctimeunputenvaltmsgmainusequencefdcomparermfproc.divchmod__filbufinplaceadmonishmemcpystrlenannotextlinkseq_nameokmkstemplocaltimestatlseekseq_getnumprint_swwhatnowprocgetanswer_finicopydonefstatfprintfmailprocWhatNowgetcpysigprocmasktrimcpylongjmpctxpathisattyverbswm_defsmakedirconcatlibsocket.so.1libnsl.so.1libc.so.1r<t8r(Tu6(a(d(((y(((());))(i)4)@5)L)X)d)pE)|)&))7){))))))O*v*  **$*0*<*H*T*`D*l[*x0****E*<***^***K+D+K+ +,+8r+D1+P+\+h4+th+++J+++++>+p+1+',,-,M,(,4,@.,L ,X_,d\,p,|,,I,Q,),f,,9,;,~,-V- -:-$-0/-<-H @D# @~~"@}@2R, @ ܖ"@@}@}㿐@/}/}خ  `    㿐H   ?#Ԥ$       ~@}˒c@@!ْ /@,"`4"?@,e~c ~@(?``@̒  `@Ɛ`? `@@ `%~ L - + @)X  * Lt224$443$3\33333d332ܐ@ߒX@  ~c0@,`4~@}wc@˒X@̔ @w @e 4@r @ `O -  @,` @" ``J@ -  @,`| z`@ L`GMr`p ` ~@,ocx@``L@ -@? @,c`:?  ~@,[c@ `L -2L @,O`L`+`@2L L`@ @?@*z `:` ~@,9c@``L@ -2-@ @,-`'@ ?? %L + @~ @,c@ + ` @*J `  @, `@@ &`@+@+k? @+ (   0@** @| @+ 8   `    @+Ғ`H"J  p@+R @)S@|?@+`x@:2  `@+   `@+@` @p @    @+`@ @*@|b 2&@+` !@@|R 2@+w`@ P@|D  P P@+ia P?Ԥ@@|2@|, d@@|)`x v?c@|# ?@+@a0!@? -@|%N!T@ Ȓ`@ߐ2@@  @ @Ȓ@(>  , 9l99999t@ ސ   3``@k `@  "   @*ap 2@0`@*a@͠@{ʐ2@*a@s@{@{@&c`"#\@  #\#`#d?  @#h@   \`h@ /?``" " !@'`` @'! @'L! ` O /!@&a` @{S!@&@',!@{b!!@&a@{;!@&ג`@'! !@*"" @&a@{"@&@&"@&" @&"0b``` \ @`B"@``&* @ "4``""H"P@|@z@{`  ``$ * @ "?  $ ?  @^@z˒bX@z `` $``"@&Y" @&Ud@za"0@&L@%nݢ H@zǐ?@z? `@zb` !̐ @@  ! @z`@zbh@z  ?#l$    ?#h$ @@ /@)O"`4"?@)c@/?c@v #@p`?#@@ `1O#ܮ%?#l ?#hL -` @&"0  }* @@@p@A(A8AtA|@\@,@"0@ 5  c@)_`4@z#`"0@y @ $ @ 4@    @)H`@ `L -2L @)<@L`+`@2L L`@ @?@'g `< @)&`X@#`L ?,%@% `J -#  @)@ `@""Ȁ``J@ -2@ @(@ @` @(`@@ n``2 L@@y͐ L@ 2 ?l@w @(C@y   L ?@(6?#h 2@y $J 2$`@y Ƞ `L `@y`#\?#h@  @ 6@ g " 4@yZ˨"xP#?#h?#p@92@@y{ @ M @@% }* DD4DPDEPDEE|D`@˒ߐ @(S`ِ`@A?Ӑ0H`@ "#\$`#\  @V?05`@`@z`@`J@ d -J` d @y%?@("`0 @x? a@( @  `@G  @ ސ `@< `@  {@ ΐ w @'a(q0?#Ę#?c@#@?##?c@#@?##?c@#@"̀ ??#Ę@ 9?@'p!8?#Ę .#@ ?#Ę'#@cĚ@@ 2!?"В /?cĚ@@#?#Ę@a@@ @'D?#Ę#@?# 4?c@@` ?#K@ /\  ?c@@@xO\?#?#` @x5aH\` 7aH\@x'?# @xQ@xP? ?@xM ?c@#@c@#@@"@x' H@x@?  \{!P@'!aX? ?@w\?c@@`?#  ?c@@ @#|!h!x@#x?cĚ@@@ߒ /?``" ?c@@`" ?#@ ?#?#@" `?##?#@ * ?``?#?c@" * " @@w ݐ X@wa?cĚ@@@w@w~?@"?G?cĚ@@@ / @wa ? #4 ?#@,"̀  "??c@@` `?#@?c@@@w? a?#a@&e\??c@@b̀` R"b?# K?c@@  E??c@@`?cز@wV@ ?4?#@<  -?@A?%??cز@w @ ??#@ ?@w#? @w ? ??#@& a?cĚ@@@%{"b?cĚ@@#?c@@`@v㻐@v̒ &?@vĒ" @%b@v?'@v$ @v"@%Ȓ(?@v@v'D'<'4@%l"@ 'L@vbP 2@v"X  @< <@ ? @%P"h 'L@v"X @<  L#\ <   v  @e /@vwbx D@qn?c@@ QX''# '@'Ė?'#? ' `4@0@q@q@䀢?2'@ /c@'.`" `@p?'.`#X`" @pޒc8.``# @ c` ` @?.`@А .`'"@p? Ԁ ?@q Ԗ'  0'#@cs̀?!ݠ H@q@q@q @q@p! @pݐ X@pc@p @p?T@? "' @%# @@&@p~@p䀢?4̐,c@Ā?@+@pn̐ @c @p^  @p{@p? c@@é㻐 @p? ?@px  ?   0#@Jc @A  @>  @;  @8 # `@p 2@HcS @pz cc`?`?`?` ? `"7@p /@p2```?`?@o?@p$@0@o`@`@`?`?`?`'@o7 @p @q@oɐ@o?2c@@ @p) @p 8@p@o#  ` x@o % /@@!@p ݐ X@oc@o@o{?㻐 4@ Ơ@o#@o|!??#쀢  `@0 @o?@`  "@odH?`@@ @H@`X@ #쀢 K @}`0F#쀢 ?@o`07#쀢 !̐ @L`!  @@$ @o@o @o @o @o  @!@` @n  @@n 0@o㻐@o!L  #쀢  @#a(0@@n? #쀢 ؐ@a@0@2 #쀢 ʐ @a`0ŀ  #쀢  a@0@n͐!L@  #쀢  @a0#쀢  ?# !@n ?ݨ X@o@o" ?@n@n@n0?@!a@A @h  2@nr@nܐ X@nܐ  #쀢 a @a0\ @nҔ @nݒa  #쀢 N @a0I$@n @@n#쀢 # ""8"H  @O !+1)%ࠐ$* @ "c쀢  "P@7@ @  $@n@㿐   ` Ȓ?@n{@m 㿐@M ? !| @bh  @@;@nWh?| !@ b@ @m@nb@b @n`  !@ :"@mǔ4%L "  " L`  L  $ @m L 瀢 L? @? $@ @n0` $` *@m@m֐@,@m @m_ ?@bȐ @mŔ @@mR@mt' @@mF@mv?!| @m` b@k  @mb? b@_ @Ő@m@mM?c@=@mTc@2c @mIc0@(c8@  @mY@Ԑ   3/! @m]- @mQ@]!pppp$@j` z* wdwdwuuuwww@ْcX chp@lz@Βcx chp@l|@Òc  ` c@Ɩ0F2 @@Ȥ@cД@l``p$@@@l``&0Op !pܔ")J@  `J@ 2 0cؐ `@@l0 `0@y@l@li `H@j@l@lo@lx?2?c@g?@l0! ?  @l  @l@@lp #`?!@l ?$` ?"@l?$ @lTc2@2`x @ Dp@l#@k!?$`@ `@lo`?"  @llc0p @`p@l  ^!pp-̐pp$@f` o* {T{T{hyyyztzt{@Ւc @kے`cД@kՖp``p$@<@l ``G0@k@ސ @k#@k!?% @`@l  ?" @lc0 @`@kpa@kp`p$@@kҒ`0  a@ `0@@k@k㿐@L@ / ~`00E@kԒ /"L`. L`  !x@kʐ 2   /.?Ф !!@k  /.?@k ?@@k ?а a@k@k ?㿐 @ @@k " "@"@ `"@ 㷈' / - @k$ VL "I  -@B -' @ @ @j@,@,@`@ @ @j@Ւ,@,@` @ @ @jٔ@’  ,@L ` *L?2@a(@  @j@a㷐 @j$@j$ # $K   2J#  @j  @j 㻐%@jr$ @jo@W8?@OaHx''@jk  @/ [ `@*b'@j!X!ݠ H@jѰ 3ݠ?%Ң#`8? &`8@j  `$  @  ?@jo :`8. .J` ?` @i!`!p@@ax@  @䀢??"  @@iɐ!@Ԑ 㿐Ґ @j6 㿐 a@˔@ȁ㿐@G㷐?@ @i@@i 㿐@iaЀ` ߒ `?"  @i @ix 㷐 @Y @i@i̐@@i @iV@A  @% @@iKh?   ?@idd @ @ir @iV߲㿐$@i2!? ?@i!@iE@i?8@?㿐@i / L  aؔ$@h@i@a@h/@i / L d a.da `.d `.d `.d `.d `.d `.d `.d `.d ` .d ` .d ` .d a$@h@iad@h㿐@i @hΐ$ @h $ @h0@iK1! $  a@c @iC &! 㿐@i= !    2    " "`@hz @hx! @i 㿐!  J@ "   @hv!?" @hh  2 @h 㿈@ [ /2 #\Ґ!($@Y 1Ґ!($"@Mb1Ұ!(@hc? `?L@ ' ?@"(2N`&N@  x@`+`@2N N`@ @?@n ` &@"8@g@a(@g@gh?%!| @b@"P`@ 1 @ \ ې @gՐ@ 2Ӑ bh@Ӡ!(@gʐ?@b@t2 b@       @2 @Ӓb` &N@ 2 ""@}  @ *  @cӐ!( ! @ #($@ @ @<@㿐  " $@g_ $  @gX $  $ @gQ @gO@!@g@gQh?@g= @g 2&  @ec0& & && & & & & & @g ?"  @g@$  & $@gb  @CcX@g?` @"!L`   @g,2 @+cX $ & &&  `& *`% + ,Ԁ .@fcx ːc@g   & @g`&  &   d& "  @g *  &  @c  4    $* "@  $      "@*`   "  @f@㿐` c@4 c@@  `@  6  `P@ @2  P @& @f* !   " "* *`$  $ @fE &  &`@f*` &  @^`" &   &   "* "@&        "* "@ $ 㿐@? V E 4R    @f` 2   `3 @f`  Ȑ@5 " !,L  - : -a, J`@  -W : @ 4 `*d!*`@P`0 a a@Ԕ  a0 @̔  aP ah@  @a߰ !,J  @4   a4@ & @ 2e  L - +?Ԑ "a( @eL") @ " L  L 2 L 2|!(  @ɐ 6@ @ &  @4@   4  "* @ " $ & 4^@  Y "    $@* `)"@@   $@* @ ?@ea @eaȀ   aaД@ 0,% $@*  ` `  "``"``2`#    `& @ 6 &  @4& `@ $ 4 㿀Ԓ "!(N@") "`J@ 2`!$!,@dʐ  !, J 2`2 ` ??.2*@@*@`N@")  `."@*@"!,@da    2j  2f?d@d~a Ԑ? "a(  T R?@dla @dfaȀ   B@?@dZb  ?  "!(  " *  2&  "  ?@d:b 2? @` 4?  " *  2  " ?㿐    @da "@ 2 @ L  @ Ԩ @c@Ԓ "!(N@ ܒ")L "L L 2 L :f`L`") @ 9 @cԒb Ԑ? "a( 4J HF @cb   "!( 9 7@ca ."!(@ca 2?Ԑ?$"a(`+`-`Ԡ`?"a(@cL") @ " L  L 2 L ",@q?,@@` :,@ c !( $ C` *@!( <   "* @   2+    "* @ "!  "*   "    `&  6 &  4&   6   ? ""("0 @?㿐@Ð"8J@  !@ 㿐ՠ!0bH@bє@ct@ڒ /Ԑ!0@bђ 1Ԑ!0bX"@b1԰!0@b㿐!֠!0b`@b@cQ@bݰ㿐"p@b@b""@ @r 4@b"@b@`}")`N " `@@< "k`@@&g``  N 2@J n2@J o2@@@b @`` "  @2@@ 0 (/pq " /q /r /s /t@b\/u@  @ @,`@  ), @  @,`  " p  "Ȑ"@@b*```@ `㿐`$"@b㿐 @bu? ?@bA  ?  0) @b0&@   @  @  @  @   @   @  #cc !ݠ 8@bc(@b 0ː  @ʒ /'P#0'T#8'X#H'\'`    "p`  `* @ a"0`@a H@a?  !#P@cX? @aPݐ X@ach@a @aw?@ ?@ L& $& (@&  aK ]$ @yx@acP h#ppp$@= ,||@ߐpp$@И@@ϐp@ @Z@a' @p@ p@M 0 cc@C@a_@a' ݦ a5 +@cȀ "+ @a"$% J@ -2   @@a` 2 @@"*@@?"     *@ &  2㿐 L@`  $`? $  $@`   ,@8  $ *` "   $  $ ,@`@`M?`$ ""`$@`"`(c@Oآ@ 5 * @@a -.@`@.@$"``@& 2&  &  4    $*   " $`@ @`QJ  ܖ)*`8 @ *   (?J  p   ?@w&     K  $ @3 $  &  $ _ #$ $ @ $@2 @_D     *@ @6 @M+@`5@`?@`+@`@`P@`P @`M @`J @`G  @ ܔА` $@_  $ "  @` @ Ȕ.` .`@_א.`: & 㿐@ ! "- '%@k 2L  ` @ʒ` $` %!@_  @_{@_y   ,  2 㿐@!! 2 @_  $! @`85!%#@- 2  @_q 4L  2  `@  @_>@ ې b $ `,b ۠@_{  $  @\`8 @ Ő$@ $  ,  b $  *b 㿐!! 2̒$"!@_Y$ $! @:` L@_$   %!@ @^{@'2s  ̀@i` *  )  $@* @ "X "U a!$ ΀@a%!@_~ a @ `a$&aa ,@A@^`@^ʐ `@   $@ * @ "$@ $@ * @   `@ $@*  $@ $@ $  @@^`@^ `@$ !` 㿐1װ!0@^k`01 㿐`L?@  㿐@ 5 @ a@ ?@u   @^@㿐!!  ̒!"!@^~$ $! @ _a )'̢ ! &Na%!@^ӓ*` $ @ Ka8N@+  . @! .& "@  @ 2 ` *  2: `Ǥ`" J@ @* 8(8` J@ @ 㿐 @    L@] 2 $ $  $    $@]ْ   $ ``  a` @ Ζb @^c,`@ "`$ @ aU "`(2"  4 ` * 8  " *` "  $   ` *   "*  "  "  $ ` .*@$    ``  *@ $   *@* $    $ 㿐 @ n   L@]U "$  $    $@]J   $ ``  a` @ ?K @]Ԑ,`@ "`$ @ 2a> "`(2  ` * 8  " *` "  $ `   & *` *  "          * $    $ 㿐 $   $@\   $  ?㿐  N  @ Ғa@ @\ǒa &@\a  @\aȀ @\aЀ @\a؀ @\a N") @ 2 N  a@    J@ `J@ 2  'L@%'D@\ H! @h /@\{b  $ @\?  O"@ mbM  / @K 'PL   LJ@ -2 "`L 'L  , P@\Ab( 2 , , @"0"p` ,  D "0`,  "0`! @\,Pݐ X@\*b8@\+ @[?@-? @ J2 ? ?:J 㿐 `2N@( $`ܤ")    @\ @ @` `@\߰ N@ ` " !!x 2.@["H $!x@\S@\i "   ` J@   @ ǒbP!@ /$!x!@[!x!x@ J /"*"h@[L @ #$b@[bp 'db@ bxL /Nb@Kݒb!xH@ "b@[bp ;'d@[`  "@ vb@\ !@\ @[@\ b @[ ݐ X@[Vb@[W @["?@Y   "@[nbp 'd @ Lbݐ!dH@ @[ad@ "蘒>K 9 / $x@ @[ @[h?'!| @ b# @7 @b  c@@ @Zِ@ 2 ch@ @Z#L  @@ _"a@[ bp  'd d@ @[d㿀'H'L'P'T'X@Z H` @Z`@Z @ Œc@H` @`㿐!!  @Z 8@[J@ $! !  @`,㻐)ݤ 8#@Zr@Z{ Hܢ") 8? % 8@Z `$ @ ?;: 8 ``",@[, ,O ?2@ZC#@ ˠ#@Z;cР  2@u 6?### @Z#    !܀ p @ @a 0fp!$ppp$@S,<<<LLp@Z1 2& @ aP&` $` @yp$@@tpp$@e@5@T$`@Y ,``"@@Jp$`,`!$` !$@@Y "   2@ ax a@Δ"!܁㿐`!`!@Y@Y@Yΐ @a@Z@Z.N@ @Ym㿐? '@Y `'  @`" F"J@ ̐@  !`7 @ 1a '%͠ ? '@Yϐ `'  @`⤀ J@ !@ 2!``@ 2` q . @Ȁ` `-|` ? '@Y `'  @`2̀` 2`,? '@Y~ `'  @`" O"J@ ̐@0  !`װ @ Ұ a 1'%͠ ? '@YM `'  @`⤀ J@ !@ 2!``@ 2`@Yb"".       , $ , `:` ?$ # @Y@?`:., a@?' ?'`:` % 4 ., b(@p ̰? ") @   * , , '?'  @@A  `@  &@$@ $ @ @X%   ?,@Xަ  2` "` "|  ?' `u'  ?' ` @'" /`-!@U@U @U @U @U  @>!!@Umcp!@Kcx! %L  "  @U0 2L @UT @@T 㿐@U@UԠ ?@Ua? ?@U,  ?  @U@U@U@U@?h@UH@UH @UE  @ڔА@U  @ϔ??́㿐 >  B@TɒbHbP6 5?#1  .@TbHb`@T  ͐!, @ "p""@T0 """@T㿐@T}@Tz@T b@TQ"   @M 2$$  ``@T*  "    `"@   `.`"`.`""" 㿐"@ 2  2 2    `@ 2`@ $"@  J@=   J@J`J J=`?㿐@TӔP'Ԑ@TZЀ 'А 'А@TƔ ?P @T  '@T<Ѐ 'А 'А@T ?㿐?4?&1> @S`)   @&   JK K  2  J "ܰ&??&:   2 㿐N") @   N 2 @S~?@ ܔ")J@ "N*@@:J@N ܖ") J@ 2*@`J@ 2 @ߐ㿐@E @SQJ /"*㻐N /*b@Sٔ  #@S=bȀ @S7bЀ b@SƔ  !ؠ!H@Sɐ@@S0@g 㿐2L@@ L@ /b@S  @SbȀ @RbЀ  b@S  1ذ!H@Rג0*!H@"ࠒL  / ax@Rb@RԐ"@ @N? / /. @R1ذ!H  *㿐@ @RJ /"*㻐`2(N !@9"@RqI@#!/"@Rd@!  @Rz@@RZ N /`2 !ِc@S  @Ric @Rcc  c @R  !Y!!H @$!H@RKc @REc B!H@R8!H!H /@R !H@"`c@R”  " @R%c  c @R  Hc(@Q&@ @R  2 Hc0@Qݔ&@ @|㿐N /sL@ /k`L@ ." / "`` \`@][,@ L /" @QML@@Qђc  @8D,@@QŒc 2@(ߢ L@ /@@8L@@(Ԣ -,@c @RC  2( L /?8L( `c@R*  2 L@`@QtL@L@ 2L@㿐@Qx @Q @c8@Q0 @Q 2. @xc8.㿐 " @ N  @  |N  㿐p! " @ 2   2 㿐ٰ!L@R$   @Gc`!x`"J@ " @Q@P?1 cْc `L*L@P* 1@Q?@ (1J@ /"*@ 1ٰ!L㿐'L'P'T'X @L㿐'L'P'T'X @Lǐ 㿐'L'P'T'Xc@L!!| H@Pː@Pɐ  4`PJ@  'P@P 'T#@P'X'\`$@$@@P$` '`N #@P$@$``$@@P$``#@P$@$``@Qn  $@$@$@@P@$```N@ "#@Pv$@$``$@@Pq$``#@Pk$@$``@P XP$@ @QC: `2J J@ *8` J  㿐 `#2#@P@`@Pܐ  `@Pא@P&  㿐" @PƐ@`@P  `@P@P& 2 㿐'P'T'X@Px ؐ@Ob@Pא4?@P@PTc࢒@OԐ'?@PŔ @P# @P ?:. &@@P $. .@O㻐c  ]"c"@OaUܪ"))͐$@O ?@P 9*@O #" @P  :,,@`L@   ܒ"),@`L@ 2,@#  # @O~ "  2 ǐ@ "@O@Oq""b@Ol#"c㻐N N \ܦ")`\" @,N f";  n b"6 4   \"0,  t) N% ?#,  2N, ,N 0    ܤ") @ON N @`?а? , N  ,@O @O-@O㺈JcȀ *c5!"J@ @Oϐ@NВ@O͐ @Oΐ "1@NƐ1"J  !͠#Ȑ@Oa"@O1Ͱ#ȁ㺈JcȀ c!"J@ @O@N㻐JaL aL@O:@OP @ "J 2 ` !1.!L!  !L.  .  #.  aL.  !.  !. @O. @N_0eK!L` b *:  <2 * ," * * K  *" K 2 K!L` >" ** K  *" "@K 2@@N&!L@N2! J ې!L@N ۢ!L@N .  1ڠb@M@N1ڰ!L㿐J!L 1a!L㿈@NL@㿐+ @N"L L&  &  &  &  gl&  &  & & (  & (@N!@Nڒ <  (& `& (& $㿐$ @N͐"x x&  &  &  &  gl&  &  & & (  & ( (& ? & (& $㿀     c * *   #\#` #d  cܰ!#Hl#d@Ml㿈@Mɐ@㿐`x t @0 2 (N `2  *!@!ܠ!#@Dcp@M<   c *  `cx  #\  #`#dܠ!#h@M  (    * c@M 1 * c@M1ܰ!㿐   @N < @N  < @N <@N <` ``` <` <`` 2  @    ` `2 ܚ" ###& @& @L 1ܰ" 㿐$ u=?;4$$``4$$  4 $$  $?$$R?`c gl'` 2!m@M d 2 !n@M! 2!m!n  `2@M d  @M! 24  Д ,@ ?. * . "* . "*  *`" * (`&1$$㿐  d ?@MP c @MC d `,`` d?,`* * ?@M0  , :`:`" @M&  (&  `& (@"`" `" ` " `" `" `" `" ` " `$" $`(" (㿐 $ 2`$1`$ 2 $+ $`$4 ` 㿐@/K/K4 ? ???㿐㿠㿠͸helpversionnowhatnowprocwhatnowproc programnouseuseform formfilefile filenoediteditor editornodraftfolderdraftmessage msgdraftfolder +foldernewrefile +folderlistreplacequitrefile -%s unknown%s [+folder] [msg] [switches]missing argument to %sonly one file at a time!only one draft folder at a time!only one draft message at a time!only one folder at a time!only one message at a time!path./Draft-Foldercan't mix forms and folders/msgscurunable to change directory tounable to read folder %sno messages in %sunable to open messageunable to open form fileunable to open default components fileunable to statDraft "%s" exists (%ld bytes). Disposition? say what?unable to openunable to createmhdraftmhfoldermhaltmsg%s/%seditalt%dmhdistmheditoreditormhusemhmessagesmhannotatemhinplace%s%s -%swhatnowunable to exec helpversionprompt stringnoediteditor editornodraftfolderdraftmessage msgdraftfolder +folderwhom []send []refile [] +folderquit [-delete]push []list []edit [ ]mime []display [] What now? -%s unknown%s [switches] [file]only one draft folder at a time!missing argument to %sonly one draft message at a time!only one draft at a time!mhdraftmhaltmsgmheditormhuse@no alternate message to displayunable to unlinkdraft left on %ssay what?editor-next%s/%sforkunable tomhfoldereditaltunable to exec viproblems with edit--draft left in %sproblems with edit--%s preservedunable to update %s fromunable to open and truncatemay have damagedautomimeproc1NOMHNPROCautomhnprocsendunable to fork, so sending directly...-pushunable to malloc memorymhn-buildrContent-snoopserver hostclient hostsomlsamlmailwidth columnsnowatchwatchnoverboseverbosenouniqueuniquesplit secondsnopushpushnomsgidmsgidnomimemimenoforwardforwardnoformatformatnofilterfilter filterfiledebugalias aliasfile-library-%s unknown %s [switches]%dusage: %s [switches]Aliasfile-aliasSIGNATUREsignaturemhannotatemhinplacemhdist-distunable to link %s torunable to open for readingMIME-VersionEncryptedMessage-IDContent-:message format error in component #%dgetfld () returned %dheaders missing from draftSending as %d Partial Messages -partno-queued<%d.%ld@%s>wunable to open for writing%s: %s 1.0%s: message/partial; id="%s"; number=%d; total=%d Content-Type%s: part %d of %d Content-DescriptionMessage-ID: %s premature eoferror writing topausing %d seconds before sending part %d... %dunable to rename %s to-idannounable to create file for annotation listforkunable tounable to exec message not delivered to anyoneunable to re-open Message not delivered to anyone. ------- Unsent Draft temporary file ------- End of Unsent Draft send failed on %senclosed draft-subjecttemporary file %s selectedunable to remove$mhaltmsg mismatchunable to fork, so doing annotations by hand...mhfolder$mhfolder not setunable to change directory tounable to read folder %sno messages in %smhmessages$mhmessages not set/dev/null no messages to annotateunable to fdopen annotation listannotate%s with %s: "%s" inplaceannotate message %dunable to lock and openannotatewunable to create%s: %s %s: %*.*sunable to open for re-readingunable to rename %s tounable to rename %s torunable to readwunable to create temporary filedistribute-%s%sResentdistribution-resentplease re-edit %s to remove the ``%s'' header!draft:%s: %splease re-edit %s to consist of headers only!please re-edit %s and fix that header!getfld() returned %dplease re-edit %s to include a ``Resent-To:''!unable to open messagedistunable to re-open temporary fileno file descriptors -- you lose bigPrev-unable to open temporary file %sformat error in message %snmh-0.24 [compiled on archimedes.gregor.com at Sat Feb 28 04:28:32 EST 1998]nmh-0.24%s/%s/opt/RCnmh/etc/%syesno/opt/RCnmh/etc/mh.profile.mh_profilecurcomponentsreplcompsreplgroupcompsforwcompsdistcompsrcvdistcompsdigestcompsmhl.formatmhl.replymhl.forwarddraftInboxinboxCurrent-FolderUnseen-SequencePrevious-SequenceSequence-Negation/opt/RCnmh/lib/opt/RCnmh/etccontext.mh_sequences/opt/RCnmh/bin/mhbuild/bin/cat/opt/RCnmh/bin/refile/opt/RCnmh/bin/inc/opt/RCnmh/lib/install-mh/usr/bin/more/opt/RCnmh/bin/mhmail/opt/RCnmh/lib/mhl/opt/RCnmh/bin/msh/opt/RCnmh/bin/packf/opt/RCnmh/lib/post/opt/RCnmh/lib/rcvstore/opt/RCnmh/bin/rmf/opt/RCnmh/bin/send/opt/RCnmh/bin/mhn/opt/RCnmh/bin/whatnow/opt/RCnmh/bin/whom/usr/bin/vi/opt/RCnmh/etc/MailAliases07000644error writingerror readingerror writingerror reading%sOptions are: -%s unknown. Hit for help. -%s ambiguous. It matches-r%.*s%s.lock,LCK.XXXXXX%.*s,LCK.XXXXXX%s%s,%.*s%s%sDraft-Foldererror on folderCreate folder ""? unable to create folder %sunable to change directory tounable to read folder %sunable to allocate folder storagecurnewonly one message draft at a time!%s/%sunable to allocate folder storageunable to allocate storage@,unable to allocate storage for msgstatsBUG: called folder_realloc with lo (%d) < 1BUG: called folder_realloc with hi (%d) < 1BUG: called folder_realloc with lo (%d) > mp->lowmsg (%d)BUG: called folder_realloc with hi (%d) < mp->hghmsg (%d)unable to reallocate message storagenewallfirst-lastillegal argument delimiter: `%c'(0%o)no %s messagemessage %s doesn't existmessage %s out of range 1-%dbad message list %sfolder full, no %s messageno messages match specificationno messages in range %scur.message %d doesn't existfirstlastprevnextcur:sequence %s %sfullemptymsg-protect%sXXXXXX%.*s%s/tmp/%sXXXXXXUsage: %s switches are: - Profile: %s [no] %s%s %s[no]%s %s -- %s unable to fork, so can't push.../dev/nullrw-nolink-nopreserve-fileforkunable tounable to exec %s/%srno blank lines are permitted in %s%s is poorly formattedatr- %s/%satr-%s-%swunable to write%s: %s bug: context_del(key="%s")unable to allocate profile storagebug: context_replace(key="%s",value="%s")unable to malloc storage in seq_list%sunable to realloc storage in seq_list-%s?%d unable to malloc array in brkstringunable to realloc array in brkstringonly %d sequences allowed (no room for %s)!strdup failedempty sequence namenewallfirstlastprevnextillegal sequence name: %smhlforkunable toshow-fileunable to exec HOMEno HOME envariableMHrunable to read/forkunable toinstall-mh-autounable to exec [install-mh aborted]path%s/%serror openingYour MH-directory "" doesn't exist; Create it? unable to access MH-directory "%s"unable to createMHCONTEXTunable to allocate string storage%sOptions are: %s %s: %s. unknownambiguouswhomprocwhatnowprocvmhprocshowprocshowmimeprocsendprocrmmprocrmfprocpostprocpackprocmshprocmoreprocmhlprocmailproclprocinstallprocincprocfileprocfaceprocbuildmimeprocmh-sequencescontextbug: m_readefs called but pump not primedunable to allocate profile storageno blank lines are permitted in %s%s is poorly formattedunable to allocate string storageeof encountered in field "%s"eol encountered in field "%s"field name "%s" exceeds %d bytesm_getfld() called with bogus state of %dFrom From  maildrop delimiter must be at least 2 bytesremote from%.*s!%.*s %.*s unable to create directoryforkunable to/bin/mkdirmkdir/usr/bin/mkdirunable to exec folder-protectwunable to write%s: %s SIGRTMAXSIGRTMINSIGCANCELSIGTHAWSIGFREEZESIGLWPSIGWAITINGfile size limit exceededcpu limit exceededprofile signalvirtual time alarmstopped (tty output)stopped (tty input)continuedstoppedstopped (signal)pollable event occurredurgent conditionwindow size changedpower faildeath of childuser-defined signal 2user-defined signal 1terminatedalarmbroken pipeinvalid system callsegmentation faultbus errorkilledfloating point exceptionEMT instructionIOT instructiontrace trapillegal hardware instructionquitinterrupthangup%s: exit %d signal %d (%s%s) , core dumped%s (core dumped)%s=%s./...../path%s/%s/%s%s/./...../%.*s%.*s/%sunable to allocate string storageunable to determine working directory/continuing...: Error %d, w+/opt/RCnmh/etc/mts.conf/var/mail/usr/spool/mail 0/opt/RCnmh/etc/hosts/usr/lib/sendmaillocalhost localnet/opt/RCnmh/etc/maildelivery-1noshelleveryonemaildeliverybbdomainpophostserversclientnamesendmailhostablemmailidmmdelim2mmdelim1uucplfiluucpldirmmdflfilmmdfldirsystemnamelocaldomainlocalnamermts.unknownThe Unknown User-ID (%d)SIGNATURE"%s"DecNovOctSepAugJulJunMayAprMarFebJanSatFriThuWedTueMonSunSaturdayFridayThursdayWednesdayTuesdayMondaySundayPDTPSTMDTMSTCDTCSTEDTESTBSTGMT%.3s %.3s %02d %02d:%02d:%02d %.4d %s%02d %s %0*d %02d:%02d:%02d%s%s, %s%s (%s)%s%02d%02d-+'@@      (h++ 00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t0000000000xh`X@0( ``xhP@  xh`PH@0x( x 8     (8HXhx 08H`p0H`x000000000000x0h0`0X0H080(0 000"@"0"("!!!!!!!!p!`!X!H!0!!        h P 8 ( "/tmp/snprintfXXXXXX#$$$$$$$$($($0$8$P$h$$$$$%6%6%6%x6%h6%X6%H6%86%(6% 6%6%6$7$7$7$7 $7$7$7&h&`&X&P&H&@&8&0&(& &&&&&&&&x&p&&&&&&&'@'8'0'(' ''''&@(#)SunOS 5.5.1 Generic May 1996as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2ld: (SGU) SunOS/ELF (LK-2.0 (S/I) - versioning).interp.hash.dynsym.dynstr.rela.bss.rela.plt.text.init.fini.rodata.got.dynamic.plt.data.ctors.dtors.bss.comment.shstrtab      ++0 )++  30t0t|9?E-M'' R''[(h(h `-X-X\f@@m@@t@@4y@N0707010000cef6000081a400000064000000640000000134f82ba60001522c000000200000001b00000000000000000000001900000004reloc/opt/RCnmh/bin/distELF0T4O 4 (44''''M''/usr/lib/ld.so.1aQ9!1^%-QIP$pB@!}(D0+ ;NK:wE[ CJm&JAB3?={.8+<.h0X-""~5E?lvO#H:a26e77)AKLuGTHDg * F>1L#|/,rO NfP& CMz) %*'3ZM`GU$FYtkW5(bo;qRxSsd/<6,c\>4I@j9Vni=2_8y4']  +h+0T  ' ' (H -8@@@6 \80P#0Tt*,1*=6F)K-RD[ Xh,,o{00\τ)h0$0<,<Ppq+, \D+0p/"/*u 2u`;0D6M X0`,iqrulw+~0|660*@*/|LDt@!0D+x*' 6 ͬ)r!,+\60\<r D0J,X ehPjhTp0y*L,D *,8(xӼ$6((,$+T(50 0X/$0-+5:+ATK0HW? _)f0xo$t(|0)6d,h0 +`0th06 Dt60400*,\lP$*d*2=0(H,PTYT0`pDk*4pdLx-(}*Pl,hp*,6x*,+l)6LtX,+ ()/)608E*|J6S/Z4b0l+<s,h{,00,' )0D0<t-+)(t@,P+(? 0*p +070`E0|M,Tx`)f0@p+xpd+0<6t0l0L*/(008*uX q6)\$6,|;u\ALK)tR@[+b8i,t)z+( ( u`+0(D@)8 P8*(\xl(60&@-(H G)MU $^0e)Dl;du(|0L0T?4}0' }8 ),ٌ00q|0d 6 r ! } 0 '0 4+ ;| B4 K/ R1, 8 W0h a0 i- n*X t+$ }/ 4 +H )  / ) 8 , , ( * P | 0 d  80 qD * )P 0 #?h$ +4 2,t > F* Nud V+ ]/ duh kp suucpldirtwsortm_tmpfilmhlreply_startrefilesigemptysetmmdfldirreadgmtimemts_initcontext_findcallocfolder_readbuildmimeprocvmhproctwscopyget_returnpathatoimh_defaultsforwcompsgetcwdSIGNALfolder_freedefpathsetuidfreadseq_listseq_setprevgetpwuidnsequencedebugswsplitswdistouttimezonemoreprocuucplfildlocaltimecatprocvfprintf_environ_endstrdupshowmimeprocpidwaitmmdlm1mmdlm2incprocgetpidforkdistfileetcpath_iobrcvdistcompsreaddir__flsbuf_GLOBAL_OFFSET_TABLE_msg_stylem_eomsbrsleepctxflagssigactionSystemNameinbox__ctypelprocgethostbynamecontext_readpathatooifileprocfseekmkdirsmatchsigaddsetgeteuidstrcasecmpatexitcontext_savebb_domainexitpidstatusstrerrorprint_versionalarmcreatsigmsgversion_strdraftseq_addmsgforwswwhomproctolowerpushaccessLocalNamedigestcompstw_dotwmallocmhetcdiruprfsprintfmshprocsymlinkNoShelladdunamegetfolderanoyesopendirmhlibdirprint_helpmsgprot_initmsg_countm_gmprotcpydataserversreplcompscomponentsdup.umuldasctimefputsdgmtimem_mailpathmh_profile_filbuflkfcloseadviseseq_addseltimelkclose.remsetjmpm_scratchlkfopenm_putenvssequalm_backupftellwritevmmdflfilshowfilepwdsscanfgetfullnamegetuidvforkmsg_delimm_maildirm_convertgetansungetcgetpwnamfclosegetenvreplgroupcompsdup2sendmailpushswambigswAliasFilemktempwaitpidsnprintfsysedcurrent_DYNAMICrenamedtimezoneseq_savedtimeinvo_nametzsetstrncmpchdirm_unknownprintf__iobexeclsetgidsetlocaletw_ldotwrmmprocfilenoSIGPROCMASKversion_numdefaultfoldercontextstrcatstrncasecmpwritedistcompsreallocgetusrstrrchrvsnprintfhostableganspsequencepostproclkopenfdopenunique_exitpackprocm_readefsmhlproccontext_deladvertiseexeclpmypathenvironEveryoneperrorpophostfolder_reallocerrnobrkstringunlinkr1bindexstrchrm_namesethostentlstatfreopenfreem_draftclosedlocaltimenow_timezoneclosedirfoldprotopenm_Eomstrcmpset_dotwcontext_replaceadiosfgetssendsbrm_atoiseq_setcurmaildeliveryfaceproc_edata_PROCEDURE_LINKAGE_TABLE_fopendmktimedtimenowmh_seqexecvpwhat_nowstrcpymhlformatmhlforwardtw_motyclosefdsm_getfld_etextcopyip_lib_versionfflushseq_readSIGNAL2sendprocshowprocannotatepfolderclientname_ctypecpydgstinstallprocrcvstoreprocgetgiddctimeunputenvaltmsgmainusequencermfproc.divchmod__filbufinplaceadmonishmemcpystrlenannotextlinkseq_nameokmkstemplocaltimestatlseekseq_getnumprint_swwhatnowprocgetanswer_finicopydonefstatfprintfmailprocWhatNowgetcpysigprocmasktrimcpylongjmpctxpathisattyverbswm_defsmakedirconcatlibsocket.so.1libnsl.so.1libc.so.1q<trTu`6(xa(d(((y((((:((i())) 4),)8)D)PD)\)h&)t)6){))))))O)v) )****(*4*@D*L[*X/*d*p*|*E*;***^***J*C*K++ +r+$0+0+<+H3+Th+`+l+xJ+++++>+p+1+'++-+L,,, .,, ,8_,D\,P,\,h,tH,Q,),f,,8,;,~,,V,,9--.--( @D# @~~!@}@2S, @ ܖ"@@}@}㿐@/}/}خ  `    㿐  ?T ?L ?D ?#l$@  ?4       ~@}c @@!ʒ /@,"`"?@,V~c(~@v0?c@@ #@@`?#@@ `)˦#~?#lL -쀢 + @)!8  * L223H3P5553X344534@3434h@Β!8@  ~c8@,`~@}ecH!8@ @ @U @ ͺ`˺ ?4@ ?4 `?4H -? @,uch?L ?L?L @" Ԁ``J@ -? @,Xch?D ?D?D  ~@,Cc@ `L - @,7ch@*m p@`C`>M@?T?T` ?T[  ~@,c@ `L -2L @, chL`+`@2L L`@ @?@*6 `9 ~@+c@`L -2,@ @+ch&@ ? "@L + @~ @+֒c@ + ` @* `  @+ǒ`@@ `@+{@+(?< @+\ 0   8@) @|x   `@+`@`"!@N@|i 2@+`h@@ @@|[  @ @@+` @ ?l@@@|I?cp@|G@ ?I ?@ )@|=' !@2@[  @!@(p  , Nx88888@B  `@ `@> "   @+` 2@@{?2@+`@@{@{ 9 !@* @(@{?@*a@z2  a0@*   aP@*@ @  @M   @*֒`@) @*;@{ ? @*Ēah ? d@ @ @T@&D?D"#\@  #\`!#`#`?T?< #d?4#h?L@ @   \`h@Y /?``" " !@&`` @&ې! @'! ` O /!@&Ȓa` @{!@&@&!@{.!!@&a@{!@&`@&! !@)Ԑ!ఒ" @&a@z!@&@&Đ!@&"@&"b``` \ @`B" ``&* @ "4``""("0@I@z@zѐ`  ``$ * @ "?  $ ?  @+@zb8@z `` $``!@&&"@&"d@z|a"@&@%;ݢ (@z?@z? `@zb@ !̐ @@  ! @z`@zbH@z ԁ ?#l$    ?#h$ @@P /@)"`"?@(c@?c@v #@p`?#@@ `1P %?#l ?#hL -` @&i"  }* @@A AAAB$B,A @ܐ@X"@ 5  c@),`@yc"@F @ $ @ @    @)c@ `L -2L @)  L`+`@2L L`@ @?@'4 `< @(`8@#`L ?,%@% `J -#  @(ܒ  `@""``J@ -2@ @(ʒ  @` @(’``@@ n``2 L@@y L@ 2 ?l@D @(@y   L ?@(?#h 2@yp $J 2$`@yd  `L `@yp`#\?#h@  @ 6@ g " @y&˨"XQ ?#h?#p@2@@yG @ M @@%h }* DDEELFEtFDF,E``@ߐ @( `ِ`@A?Ӑ0H`@ "#\$`#\  @V?05`@s`@z`@`J@ d -J` d @x?@'`0 @x? `@'ٔ@  `@G  @ ސ `@< `@ْ {@ ΐ w @'aq0?#Ę#?c@#@?##?c@#@?##?c@#@" ??#Ę@ 9?@'=!?#Ę .#@ ?#Ę'#@cĚ@@ 2!?" /?cĚ@@Q#?#Ę@a @ @'?#Ę#@?# 4?c@@` ?#K@ /\  ?c@@@x\?#?#` @xa(\` 7a(\@w?# @x@x? ?@x ?c@#@c@#@@"@w (@x ?  \{!0@&a8? ?@w\?c@@`?#  ?c@@ @#I!H!X@#E?cĚ@@@ /?``" ?c@@`" ?#@ ?#?#@" `?##?#@ * ?``?#?c@" * " @@w ݐ 8@wa`?cĚ@@@w@wJ?@"?G?cĚ@@@S / @wcap ? #4 ?#@,"  "??c@@` `?#@?c@@@wU? ax?#a@&2\??c@@b` R"b?# K?c@@  E??c@@`?cز@w"@ ?4?#@<  -?@A?%??cز@vӒ@ ??#@ ?@v? @v? ??#@%֒a?cĚ@@@%H"b?cĚ@@#?c@@`@vȐ㻐@v &?@v" @%Ēa@v?'@v$ @v"@%?@v|@vz'D'<'4@%9" 'L@vyb0 2@vj"8  @< <@ ? @%"H 'L@vT"8 @<  L#\ <   v  @2 /@vCbX D$ @r@r@rbː?"c?d?\@#؀   !@r@r ( / !?d  / p?d #܀   / !?d  @r7l!@r6! l@"@qƖ@r+ ?x @@q@ra@ b@r!@rb @qǖ(b0h@qbx@q @qb@q@qb .##@qԔ  @ @q @qђ @qƔ @q| ?x@ b@q#؀ !#䀢  #@qS"@qb (!#܀`p#؀  "@q>@qM (@qu#ܐpc@q%?d?\@,@qJ˦V"#@q@q @q[2@@q@q:?c @ X''#؀ '@'Ė?'#ؘ? '# `@ @pِ@q 䀢?2'@c '.`"#쀢 `@p?'.`#8`" @pc.``# @c@#` @?.`@А .`'"@p? Ԁ ?@pҐ Ԗ'  0'#p@cxs̀?!ݠ (@p@p@pސ @p@p|! @pݐ 8@pc@p @pT?T@? "'#쀢 @%#܀ @@@pG@pz䀢?4̐,c Ā?@+@p@ː @Pc#쀢 @p0# @pG@pO? c @2́㻐 @px? ?@pD  ?   0#p@cx @  @   @  @ #Ѐ `@oޒ 2@cS @pF cРc`?`?`?` ? `"7@o/@occ`?`?@o?@o@@o` ` `?`?`?`'@o7 @o֒@>@o@oŐ?2c @Ô @o @o @o@o#Ж  @ X@oe % /@o@ Рh@oԚ ݐ 8@o{c@o|@oG?㻐 @ @oL#@oE!??#̀  `x@\0 @oa?@S`#耢 "@o*H?`@@ @H@`X@ #̀ K @J`0F#̀ ?@ov`07#̀ !ː @`!# @@$#@ob@ob @o_ @o\ @oY  @@` @nÐ  @@n#0@nԐ㻐@nԐ L  #̀  @a0@p@n? #̀ ؐ@a 0@R2 #̀ ʐ @Ӓa@0ŀ  #̀  a`@Ɣ0@n!xL@  #̀  @a0#̀  ?#؀ !@ni ?ݨ 8@nΐ@n" ?@nƐ@nƐ@nd0?@a@ @5  2@n>@n 8@n  #̀ a @la0\ @n @n`谒  #̀ N @Ya0I$@nn @x@nY#̀ #Ԁ !""( @ !+1)%ࠐ$* @ "c̀  "0@@f#@  $@mΐ@f㿐#  ` ?@nG@m 㿐@ ? !\ @bH  @@@n#h?| !@ b`@ @m@mϒbp@bx @m`  !@ "@m4%L "  " L`  L  $ @mv L 瀢 L? @? $@ @m͒0` $` *@mS@m@@m| @m( ?@Qb @m @@m$@m@' @@m@mB?!\ @m, b@8  @m.? b@, @@l@m?b@ @m b@c@mc@c@ բ @m%@Ԑ   3/!#@m)-#@m@u]"`pppp$@7` z* xxx4vvvwwxP@c8 cHP@lz@cX cHP@lu|@ch  ` cp@0F2 @ђ@͐@ɒc@l}``p$@@@l``&0Op !pܔ" J@  `J@ 2 0c c@M@lt0 `@Qy@lj@l5 `(@7@l^@l;@lD?2?b@4?@k! ?  @lm  @la@@l< #c?!@k?$c ?"@k?$ @l b2@`X p@ p@kʐ#@kÔ!?$c@`x@l;c?"  @l8cp @ޒ`p@kא ^"ppp-̐pp$@3` o* |||zzz{${$|4@ch @k`Ȑc@kp``p$@ @kْ``G0@k@ p@kd#@k]!?%@`@k?" @kҒc @y`@ksp`@kep`p$@Θ@k`0  `@] `@X@kq@ko㿐@eL@ / ~`00E@k /"L`. L`  !X@k 2   /.?Ф !x!@j  /.?@k ?@@kw ?а ؐa@jҔ@kk ?㿐 @ @@jא " "@"@ `"@ 㷈' / - @j$ VL "I  -@B -' @ @ @jʔ@,@,@`@ @ @j@,@,@` @ @ @j@  ,@L ` *L?2@xa@  @j@l`㻐%@jq$ @jn@W?@Oa(x''@jj ؀  @/ [ `@*a'@j!8!ݠ (@jѰ 3ݠ?%Ң#`? &`@j  `$  @  ?@jn :`. .J`؀ ?`؀ @iߐ!@!P@@aX@  @䀢??"  @@i!`@Ԑ 㿐Ґ @j5 㿐 a@˔@㿐@G㷐?@ @i@@i 㿐@ia` ߒ `?"  @i @i} 㷐 @Y @i@iː@@i @iR@A  @% @@iDh?   ?@idd @ @iq @iU߲㿐$@i+!? ?@i&@iD@i>8@?㿐@i / L  a$@h@i @a@h/@i / L d a.da `.d `.d `.d `.d `.d `.d `.d `.d ` .d ` .d ` .d aؔ$@h@i`d@h㿐@i @h͐$ @h $ @h0@iJ1 쀢 $  a@c@iB & 㿐@i<  쀢    2  쀤 ""`@hy @hw 쀢 @i 㿐 쀤  J@ "   @ho!?" @hm  2 @h 㿈@ [ /2 #\Ґ!$@Y 1Ґ!$"@Ma1Ұ!@hb? `?L@ ' ?@"2N`&N@  X@`+`@2N N`@ @?@n ` &@"@h@a@g@gh?%!\ @b "0@@ 1 @ \  @gԐ@ 2Ӑ bH@Ӡ!@gې?@bh@t2 b@       @2 @Ӓb` &N@ 2 ""@}  @ *  @bӐ! ! @ #$@ @ @<@㿐  " $@g^ $  @gW $  $ @gP @gN@!@g@gJh?@g< @g 2&  @ec& & && & & & & & @g ?"  @g@$  & $@ga  @Cc8@g?` @"!L`   @g,2 @+c8 $ & &&  `& *`% + ,Ԁ .@fcX ːc`@g   & @g`&  &   d& "  @g *  &  @ch  4    $* "@  $      "@*`   "  @f@㿐` c@4 c@@  c@  6  `0@ @2  P @& @f* !   " "* *`$  $ @fD &  &`@f*` &  @^`p" &   &   "* "@&        "* "@ $ 㿐@? V E 4R    @f` 2   `3 @f`  @5 " ! L  - : -a  J`@  -W : @ 4 `*d!ԓ*`@4D ` `@Ԕ  a @̔  a0 aH@  @ah߰ ! J  @4   a4@ & @ 2e  L - +?Ԑ "a @eL" @ " L  L 2 L 2|!  @ɐ 6@ @ &  @4@   4  "* @ " $ & 4^@  Y "    $@* `)"@@   $@* @ ?@ea @ea   `a@ 0,% $@*  ` `  "``"``2`#    `& @ 6 &  @4& `@ $ 4 㿀Ԓ "!N@" "`J@ 2`!$! @dɐ  !  J 2`2 ` ??.2*@@*@`N@"  `."@*@"! @daЀ    2j  2f?d@d}a؀ Ԑ? "a  T R?@dka @dea   B@?@dYa  ?  "!  " *  2&  "  ?@d9a耢 2? @` 4?  " *  2  " ?㿐    @da !@ 2 @ pL  @ Ԩ @c@Ԓ "!N@ ܒ" L "L L 2 L :f`L`" @ 9 @cӒa Ԑ? "a 4J HF @ca耢   "! 9 7@caЀ ."!@ca؀ 2?Ԑ?$"a`+`-`Ԡ`?"a@cL" @ " L  L 2 L ",@q?,@@` :,@ c ! $ C` *@! <   "* @   2+    "* @ "!  "*   "    `&  6 &  4&   6   ? !"" @?㿐@Ð"J@   @ 㿐ՠ!b(@bД@cs@ڒ /Ԑ!@b͒ 1Ԑ!b8"@b1԰!@b㿐!֠!b@@b@cP@bܰ㿐"P@b@b"`"x@ @r @b"@b@`}")`N " `@@< "k`@@&g``  N 2@J n2@J o2@@@b @`` "  @2@@ 0 (/pq " /q /r /s /t@b[/u@  @ @,`@  ), @  @,`  " p  ""@@b#```@ `㿐`"@b㿐 @bt? ?@b@  ?  0) @b0&@   @  @  @  @   @   @  #bc!ݠ @bc@b 0  @ʒ /'P#'T#'X#('\'`    "p`  `* @ a"0`@a (@a?  !#0@c8? @aPݐ 8@acH@a @av?@ ?@ ,& $& (@&  aK ]$ @yX@ac`P h#ppp$@= ,``@ߐpp$@И@@ϐp@ @Z@a& @p@ p@M 0 chc@C@a^@a& ݦ ah5 +@c "+ @a"$% J@ -2   @@a` 2 @@"*@@?"     *@ &  2㿐 ,@`  $`? $  $@`   ,@8  $ *` "   $  $ ,@`@`M?`$ ""`$@`"`(c@O@ 5 * @@a -.@`@.@$"``@& 2&  &  4    $*   " $`@ @`PJ  ܖ *`8 @ *   (?J  p   ?@w&     K  $ @3 $  &  $ _ #آ$ $ @ $@2 @_D     *@ @6 @M+@`4@`?@`*@c@`O@`O @`L @`I @`F  @ ܔАc $@_  $ "  @` @ Ȕ.` .`@_֐.`: & 㿐@ !h "- '%@k 2L  ` @ʒ` $` %!h@_  @_z@_x   , 2 㿐@!!h 2 @_  $!h @`5!h%#@- 2  @_p 4L  2  @@  @_=@ ې b$ `,b ۠@_z  $  @\` @ Ő$@ $  ,  b$  *b㿐! 2̒$" @_X$ $  @:`p ,@_#   %!@ @^{@'2s  ̀@i` *  )  $@* @ "X "U ` $ ΀@`% @_} ` @ ``$&`` ,@A@^`@^ɐ `@   $@ * @ "$@ $@ * @   `@ $@*  $@ $@ $  @@^`@^ `@$  ` 㿐1װ!@^j`01 Ё㿐`,?@  㿐@ 5 l @ `@蠒 ?@u   @^?㿐!  ̒!" @^}$ $  @ _` )'̢  &Na% @^ғ*` $ @ KaN@+  . @! .& "@  @ 2 ` *  2: `Ǥ`" J@ @* 8(8` J@ @ 㿐 @    ,@] 2 $ $  $    $@]ؒ   $ ``  a@ @ Ζb @^b,`@ "`$ @ apU "`(2"  4 ` * 8  " *` "  $   ` *   "*  "  "  $ ` .*@$    ``  *@ $   *@* $    $ 㿐 @ n   ,@]T "$  $    $@]I   $ ``  a@ @ ?K @]Ӑ,`@ "`$ @ 2ap> "`(2  ` * 8  " *` "  $ `   & *` *  "          * $    $ 㿐 $   $@\   $  ?㿐  N  @ Ғa@ @\ƒa &@\a  @\a @\a @\a @\a N" @ 2 N  a@    J@ `J@ 2  'L@%'D@\~ (! @h /@\za耢  $ @\?  O!@ maM  / @K 'PL   LJ@ -2 "`L 'L  , P@\@b 2 , , @""p` ,  D "0`,  "0`! @\+Pݐ 8@\)b@\* @[?@-? @ J2 ? ?:J 㿐 `2N@( $`ܤ"    @\ @ @` `@\߰ N@ ` ! !!X 2.@["( $!X@\R@\h "   ` J@   @ ǒb0!@ /$!X!@[!X!X@ J /"*"H@[L @ #$a@[bP 'da@ bXL /Na@Kݒbh!X(@ "a@[bP ;'d@[`  "p@ vbx@\ !@\ @[@\ b @[ ݐ 8@[Ub@[V @[!?@Y   !@[mbP 'd @ Lbݐ!hd(@ @[`d@ "Ș>K 9 / $X@ @Z @Zh?'!\ @ b"@7 @b  c @ @Zؐ@ 2 cH@ @Z#`L  |@@ _"ad@[bP  'd d@ @[d㿀'H'L'P'T'X@Z H` @Z`@Z @ Œcp@H` @`㿐!!  @Z @[I@ $!!  @` 㻐)ݤ #@Zk@Zz (ܢ"  ? % @Z `$ @ ?;:  ``",@[, ,O ?2@Z<#@ ˠ#@Z4c  2@u 6?###А @Z    ! p @ @a0fp!ppp$@S,   00T@Z0 2& @ a0&` $` @yp$@@tpp$@e@5@T$`@Y ,``"@@Jp$`,`!` !@@Y "   2@ aX a@Δ"!㿐`!`!@Y@Y@Y͐ @a@Z@Z.N@ @Yl㿐? '@Y `'  @`" F"J@ ̐@  !`7 @ 1a '%͠ ? '@Yΐ `'  @`℀ J@ !@ 2!``@ 2` q . @ĬĬĬ` `-|` ? '@Y `'  @`2̀` 2`,? '@Y} `'  @`" O"J@ ̐@0  !`װ @ Ұ a 1'%͠ ? '@YL `'  @`℀ J@ !@ 2!``@ 2`@Ya"".       , $ , `:` ?$ # @Y??`:., a@?' ?'`:` % 4 ., b@p ̰? " @   * , , '?'  @@A  `@  &@$@ $ @ @X%   ?,@Xݦ  2` "` "|  ?' `u'  ?' ` @'" /`-!!!@ɖ&@"  a* @!@@ @" @ &@  ?@XO "@'' )""#., a@?  &@ @X4' "'  "@''  b0@,͐$"b㿀%͐ $@Wʐ  @XD #b`@X   $"h̠!? &@W `&  @ ",, @W b̀ "J 2"p"b"͐ "b@WJ@Ww'ؒ $* #!*ؐ"$a$$"@W" "a$!ؐ `$! @?bx!@W ؔ"a!  : L* "  *Lb / #!? &@W `&  @℀ bJ !@; 2!`@ 2@W㿐̀ "!͒ ""* "a!"!͐ "b!!͒ @V$""a"!$ؒ@"㿀@V !!$@Wn!$  a @W@  " 0@V @? &@@W% ` &`  "  ̠!@? &@@V ``&` @  &,, , 㿐̤!Ȑ@Vے 7 ' @VҒ r" @V  @VҒ  @V "b$@@V" L@bȔ$@@VL@L@ "`bȔ @V*!Ȱ  " @@`(`8J (`8 (J    KJ   *K *J @ ? $  @ `  㻈@'@U (@Vy@V&@Uɐ%ݢ / @VP /.@VP   \ I@V! E.@V!퀢?C;@U?  %".b@VZ!@V[#@V;@VZ#@Vl # @Vf ݐ 8@Uc0@U@Um?@?ݒ`(@”   0b@ 0@<#@  @ @U㿐    @V7L?Р  @ ?А p b C ?@C*b>@U@U @U @U @U  @>!!d@UlcP!d@KcX!h %L  "  @U/h 2L @US @@T 㿐@U@UӠ ?@U`? ?@U+  ?  @U@U@U@U@?h@UG@UG @UD  @ڔА@U  @ϔ??́㿐 >  B@TȒb(b06 5?#1  .@Tb(b@@T  ͐!ȓ, @ "P"`"p@T0 "x""p@T㿐@T|@Ty@T b@TP!   @M 2$$  ``@T*  !    `"@   `.`"`.`""! 㿐!@ 2  2 2    `@ 2`@ $"@  J@=   J@J`J J=`?㿐@TҔP'Ԑ@TYЀ 'А 'А@TŔ ?P @T  '@T;Ѐ 'А 'А@T ?㿐?4?&1> @S`)   @&   JK K  2  J "ܰ&??&:   2 㿐N" @   N 2 @S}?@ ܔ" J@ "N*@@:J@N ܖ"  J@ 2*@`J@ 2 @ߐ㿐@E @SPJ /"*㻐N /*b@Sؔ  #@S<b @S6b b@SŔ  !ؠ!(@S ɐ@@S0@g 㿐2L@@ L@ /b@S  @Sb @Rb  b@S  1ذ!(@RӒ0*!(@"L  / aX@Rb@RӐ"@ @N? / /. @R1ذ!(  *㿐@ @RJ /"*㻐`2(N !@9"Д@RpI@"!/"ؔ@Rc@!  @Ry@@RY N /`2 !ِb@S  @Rhb @Rbb  c@R  !Y!!( @$!(@RJb @RDb耢 B!(@R7!(!( /@R !(@"`b@R  " @R$b  c@R  (c@Q&@ @R  2 (c@Qܔ&@ @|㿐N /sL@ /k`L@ ." / "`` \`@][,@ L /" @QML@@QВb  @8D,@@QĒb 2@(ߢ L@ /@@8L@@(Ԣ -,@c@RB  2( L /?8L( `b@R)  2 L@`@QpL@L@ 2L@㿐@Qw @Q @c@Q0 @Q 2. @xc.㿐 " @ dN  @  \N  `㿐p!h " @ 2   2 㿐ٰ!,@R$   @Gc@!X`"J@ " @Q@Q ?1 chْch `,*,@Q* 1@Q?@ (1J@ /"*@ 1ٰ!,㿐'L'P'T'X @L㿐'L'P'T'X @L 㿐'L'P'T'Xcp@L!!\ (@Pʐ@PȐ  `PJ@  'P@P 'T#@P'X'\`$@$@@P$` '`N #@P$@$``$@@P$``#@P$@$``@Qm  $@$@$@@P@$```N@ "#@Pu$@$``$@@Pp$``#@Pj$@$``@P 8P$@ @QB: `2J J@ *8` J  㿐 `#2#@P@`@Pې  `@P֐@P&  㿐" @PŐ@`@P  `@P@P& 2 㿐'P'T'X@Px ؐ@Oߒb@P֐4?@P@PSc@Oِ'?@PĔ @P" @P?:. &@@P $. .@O㻐c  ]"c"@OaUܪ" )͐$@O ?@P 9*@O #" @P :,,@`L@   ܒ" ,@`L@ 2,@#  #@O} "  2 ǐ@ "@O@Op""b@Ok""b㻐N N \ܦ" `\" @,N f";  n b"6 4   \"0,  t) N% ?#,  2N, ,N 0    ܤ"  @ON N @`?а? , N  ,@N @O,@O㺈Jc *c5!"J@ @Oΐ@N̒@O̐ @O͐ "1@N1"J  !͠#@Oa"@O1Ͱ#㺈Jc c!"J@ @O@N㻐Ja, a,@O9@OO @ "J 2 ` !1.!,!  !,.  .  #.  a,.  !.  !. @O. @N^0eK!,` bЀ *:  <2 * ," * * K  *"Ѐ K 2 K!,` >" ** K  *"Ѐ "@K 2@@N"!,@N1!ؖ J ې!,@N ۢ!,@N .  1ڠa@M@N1ڰ!,㿐J!, 1a!,㿈@NK@㿐+ @N", ,&  &  &  &  gl&  &  & & (  & (@N!`@Nْ <  (& `& (& $㿐$ @N̐"X X&  &  &  &  gl&  &  & & (  & ( (& ? & (& $㿀     c * *   #\#` #d  cܰ!#(l#d@Mk㿈@MȐ@㿐`x t @0 2 (N `2  *!@!ܠ!#@DcP@M;   c *  `cX  #\  #`#dܠ!#h@M (    ܕ* cx@M 1 ܕ* c@M1ܰ!㿐   @N < @N  < @N  <@N <` ``` ` `` 2  @    ` `2 ܚ!###& @& @L 1ܰ!㿐$ u=?;4$$``4$$  4 $$  $?$$R?`c gl'` 2!m@M d 2 !n@M! 2!m!n  `2@M d  @M! 24  Д `,@ ?. * . "* . "*  *`" * (`&1$$㿐  d ?@MO c @MB d `,`` d?,`* * ?@M/  , :`:`" @M%  (&  `& (@"`" `" ` " `" `" `" `" ` " `$" $`(" (㿐 $ 2`$1`$ 2 $+ $`$4 ` 㿐@/K/K0 ? ???㿐㿠㿠ͷfile filehelpversionnowhatnowprocwhatnowproc programnoinplaceinplaceform formfilenoediteditor editornodraftfolderdraftmessage msgdraftfolder +foldernoannotateannotatenewrefile +folderlistreplacequit -%s unknown%s [+folder] [msg] [switches]missing argument to %sonly one file at a time!only one draft folder at a time!only one draft message at a time!only one folder at a time!only one message at a time!path./can't mix files and folders/msgsunable to open form fileunable to open default components fileDraft "%s" exists (%ld bytes). Disposition? say what?unable to createcurunable to change directory tounable to read folder %sno messages in %sunable to open messageResentmhdraftmhfoldermhaltmsg%s/%seditalt%dmhdistmheditoreditormhusemhmessagesmhannotatemhinplace%s%s -%swhatnowunable to exec helpversionprompt stringnoediteditor editornodraftfolderdraftmessage msgdraftfolder +folderwhom []send []refile [] +folderquit [-delete]push []list []edit [ ]mime []display [] What now? -%s unknown%s [switches] [file]only one draft folder at a time!missing argument to %sonly one draft message at a time!only one draft at a time!mhdraftmhaltmsgmheditormhuse@no alternate message to displayunable to unlinkdraft left on %ssay what?editor-next%s/%sforkunable tomhfoldereditaltunable to exec viproblems with edit--draft left in %sproblems with edit--%s preservedunable to update %s fromunable to open and truncatemay have damagedautomimeproc1NOMHNPROCautomhnprocsendunable to fork, so sending directly...-pushunable to malloc memorymhn-buildrContent-snoopserver hostclient hostsomlsamlmailwidth columnsnowatchwatchnoverboseverbosenouniqueuniquesplit secondsnopushpushnomsgidmsgidnomimemimenoforwardforwardnoformatformatnofilterfilter filterfiledebugalias aliasfile-library-%s unknown %s [switches]%dusage: %s [switches]Aliasfile-aliasSIGNATUREsignaturemhannotatemhinplacemhdist-distunable to link %s torunable to open for readingMIME-VersionEncryptedMessage-IDContent-:message format error in component #%dgetfld () returned %dheaders missing from draftSending as %d Partial Messages -partno-queued<%d.%ld@%s>wunable to open for writing%s: %s 1.0%s: message/partial; id="%s"; number=%d; total=%d Content-Type%s: part %d of %d Content-DescriptionMessage-ID: %s premature eoferror writing topausing %d seconds before sending part %d... %dunable to rename %s to-idannounable to create file for annotation listforkunable tounable to exec message not delivered to anyoneunable to re-open Message not delivered to anyone. ------- Unsent Draft temporary file ------- End of Unsent Draft send failed on %senclosed draft-subjecttemporary file %s selectedunable to remove$mhaltmsg mismatchunable to fork, so doing annotations by hand...mhfolder$mhfolder not setunable to change directory tounable to read folder %sno messages in %smhmessages$mhmessages not set/dev/null no messages to annotateunable to fdopen annotation listannotate%s with %s: "%s" inplaceannotate message %dunable to lock and openannotatewunable to create%s: %s %s: %*.*sunable to open for re-readingunable to rename %s tounable to rename %s torunable to readwunable to create temporary filedistribute-%s%sResentdistribution-resentplease re-edit %s to remove the ``%s'' header!draft:%s: %splease re-edit %s to consist of headers only!please re-edit %s and fix that header!getfld() returned %dplease re-edit %s to include a ``Resent-To:''!unable to open messagedistunable to re-open temporary fileno file descriptors -- you lose bigPrev-unable to open temporary file %sformat error in message %snmh-0.24 [compiled on archimedes.gregor.com at Sat Feb 28 04:28:32 EST 1998]nmh-0.24%s/%s/opt/RCnmh/etc/%syesno/opt/RCnmh/etc/mh.profile.mh_profilecurcomponentsreplcompsreplgroupcompsforwcompsdistcompsrcvdistcompsdigestcompsmhl.formatmhl.replymhl.forwarddraftInboxinboxCurrent-FolderUnseen-SequencePrevious-SequenceSequence-Negation/opt/RCnmh/lib/opt/RCnmh/etccontext.mh_sequences/opt/RCnmh/bin/mhbuild/bin/cat/opt/RCnmh/bin/refile/opt/RCnmh/bin/inc/opt/RCnmh/lib/install-mh/usr/bin/more/opt/RCnmh/bin/mhmail/opt/RCnmh/lib/mhl/opt/RCnmh/bin/msh/opt/RCnmh/bin/packf/opt/RCnmh/lib/post/opt/RCnmh/lib/rcvstore/opt/RCnmh/bin/rmf/opt/RCnmh/bin/send/opt/RCnmh/bin/mhn/opt/RCnmh/bin/whatnow/opt/RCnmh/bin/whom/usr/bin/vi/opt/RCnmh/etc/MailAliases07000644error writingerror readingerror writingerror reading%sOptions are: -%s unknown. Hit for help. -%s ambiguous. It matches-r%.*s%s.lock,LCK.XXXXXX%.*s,LCK.XXXXXX%s%s,%.*s%s%sDraft-Foldererror on folderCreate folder ""? unable to create folder %sunable to change directory tounable to read folder %sunable to allocate folder storagecurnewonly one message draft at a time!%s/%sunable to allocate folder storageunable to allocate storage@,unable to allocate storage for msgstatsBUG: called folder_realloc with lo (%d) < 1BUG: called folder_realloc with hi (%d) < 1BUG: called folder_realloc with lo (%d) > mp->lowmsg (%d)BUG: called folder_realloc with hi (%d) < mp->hghmsg (%d)unable to reallocate message storagenewallfirst-lastillegal argument delimiter: `%c'(0%o)no %s messagemessage %s doesn't existmessage %s out of range 1-%dbad message list %sfolder full, no %s messageno messages match specificationno messages in range %scur.message %d doesn't existfirstlastprevnextcur:sequence %s %sfullemptymsg-protect%sXXXXXX%.*s%s/tmp/%sXXXXXXUsage: %s switches are: - Profile: %s [no] %s%s %s[no]%s %s -- %s unable to fork, so can't push.../dev/nullrw-nolink-nopreserve-fileforkunable tounable to exec %s/%srno blank lines are permitted in %s%s is poorly formattedatr- %s/%satr-%s-%swunable to write%s: %s bug: context_del(key="%s")unable to allocate profile storagebug: context_replace(key="%s",value="%s")unable to malloc storage in seq_list%sunable to realloc storage in seq_list-%s?%d unable to malloc array in brkstringunable to realloc array in brkstringonly %d sequences allowed (no room for %s)!strdup failedempty sequence namenewallfirstlastprevnextillegal sequence name: %smhlforkunable toshow-fileunable to exec HOMEno HOME envariableMHrunable to read/forkunable toinstall-mh-autounable to exec [install-mh aborted]path%s/%serror openingYour MH-directory "" doesn't exist; Create it? unable to access MH-directory "%s"unable to createMHCONTEXTunable to allocate string storage%sOptions are: %s %s: %s. unknownambiguouswhomprocwhatnowprocvmhprocshowprocshowmimeprocsendprocrmmprocrmfprocpostprocpackprocmshprocmoreprocmhlprocmailproclprocinstallprocincprocfileprocfaceprocbuildmimeprocmh-sequencescontextbug: m_readefs called but pump not primedunable to allocate profile storageno blank lines are permitted in %s%s is poorly formattedunable to allocate string storageeof encountered in field "%s"eol encountered in field "%s"field name "%s" exceeds %d bytesm_getfld() called with bogus state of %dFrom From  maildrop delimiter must be at least 2 bytesremote from%.*s!%.*s %.*s unable to create directoryforkunable to/bin/mkdirmkdir/usr/bin/mkdirunable to exec folder-protectwunable to write%s: %s SIGRTMAXSIGRTMINSIGCANCELSIGTHAWSIGFREEZESIGLWPSIGWAITINGfile size limit exceededcpu limit exceededprofile signalvirtual time alarmstopped (tty output)stopped (tty input)continuedstoppedstopped (signal)pollable event occurredurgent conditionwindow size changedpower faildeath of childuser-defined signal 2user-defined signal 1terminatedalarmbroken pipeinvalid system callsegmentation faultbus errorkilledfloating point exceptionEMT instructionIOT instructiontrace trapillegal hardware instructionquitinterrupthangup%s: exit %d signal %d (%s%s) , core dumped%s (core dumped)%s=%s./...../path%s/%s/%s%s/./...../%.*s%.*s/%sunable to allocate string storageunable to determine working directory/continuing...: Error %d, w+/opt/RCnmh/etc/mts.conf/var/mail/usr/spool/mail 0/opt/RCnmh/etc/hosts/usr/lib/sendmaillocalhost localnet/opt/RCnmh/etc/maildelivery-1noshelleveryonemaildeliverybbdomainpophostserversclientnamesendmailhostablemmailidmmdelim2mmdelim1uucplfiluucpldirmmdflfilmmdfldirsystemnamelocaldomainlocalnamermts.unknownThe Unknown User-ID (%d)SIGNATURE"%s"DecNovOctSepAugJulJunMayAprMarFebJanSatFriThuWedTueMonSunSaturdayFridayThursdayWednesdayTuesdayMondaySundayPDTPSTMDTMSTCDTCSTEDTESTBSTGMT%.3s %.3s %02d %02d:%02d:%02d %.4d %s%02d %s %0*d %02d:%02d:%02d%s%s, %s%s (%s)%s%02d%02d-+'@@ z     (H++h 00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t0000000000xh`P8( xh`X`H0 xp`XH@0( `XX  h       (8HXhx(@Ph(@Xp0|000000000p0h0X0H0@080(000000" ""!!!!!!!!h!P!@!8!(!       x p ` H 0  p"/tmp/snprintfXXXXXX########$$$$$0$H##$`$#%6%x6%h6%X6%H6%86%(6%6%6%6$6$6$6$6$6$6$6$6$6&H&@&8&0&(& &&&&%%&&x&p&h&`&X&P&&&&&&&' ''''&&&&&@(#)SunOS 5.5.1 Generic May 1996as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2ld: (SGU) SunOS/ELF (LK-2.0 (S/I) - versioning).interp.hash.dynsym.dynstr.rela.bss.rela.plt.text.init.fini.rodata.got.dynamic.plt.data.ctors.dtors.bss.comment.shstrtab     +h+h0 )++  30T0Tɀ9?E-M'' R''[(H(H `-8-8\f@@m@@t@@4y@ N0707010000cef7000081a400000064000000640000000134f82ba60000b1b0000000200000001b00000000000000000000001a00000004reloc/opt/RCnmh/bin/flistELF%H44 (440X/usr/lib/ld.so.19@C)Mu#_$x}mj~yIdWJbzp1q/A<N&Ki0h'"34USl^8ov`5s-e.wc!*G>HZ][XBr76g+;nED?fYVO{ :Q%R|,2ka=(LtFPT\,!!%H|| |   , 08@H %Ht&@/uh8o0XEL6Xf`nZ}DdLP6Tpp4Lt X` P'T.$6;4DC@!HU+em  Xx8y8\ ,D ixP^xT  e"s8-2`:\A^$NtXh]a(gPp<,$~PhH|xx<Mtnh 9h$x,|2<lDNY_g$jul}pd0b<rhx\Do{,fL`p* d$6 4,p6 >t4,GOlU] fpXx2U,x4@Pd0 sx",L4<t`FydM`VJ,t[eDnut{@K8qt| pBLtD@d /d(!t*YT@07AlPGp8MSAlZxgp@w, 2PDN$ 58| 0\FIuucpldirmhlreply_startsigemptysetmmdfldirmts_initcontext_findcallocfolder_readbuildmimeprocvmhprocget_returnpathmh_defaultsatoiforwcompsgetcwdSIGNALfolder_freedefpathsetuidfreadgetpwuidnsequencemoreprocuucplfilcatprocvfprintf_environ_endshowmimeprocpidwaitmmdlm1mmdlm2incprocforketcpath_iobrcvdistcompsBuildFolderListreaddir_GLOBAL_OFFSET_TABLE_msg_stylem_eomsbrsleepctxflagssigactionSystemNameinbox__ctypelprocgethostbynamecontext_readpathatooifileprocfseekmkdirsmatchsigaddsetgeteuidstrcasecmpAllocFoldersatexitcontext_savebb_domainexitpidstatusstrerrorprint_versionsigmsgversion_strdraftwhomproctoloweraccessLocalNamedigestcompsmallocmhetcdirsprintfmshprocNoShelladdunamegetfolderopendiranoyesmhlibdirprint_helpmsgprot_initmsg_countserversreplcompscomponents.umulm_mailpathmh_profile_filbufadvisem_putenvssequalftellwritevmmdflfilpwdgetfullnamegetuidvforkmsg_delimm_maildirqsortungetcgetpwnamScanFoldersfclosegetenvreplgroupcompssendmailambigswAliasFilewaitpidsnprintfstrncpysysedcurrent_DYNAMICinvo_namestrncmpAssignPrioritychdirm_unknownBuildFolderListRecurseprintf__iobexeclsetgidsetlocalermmprocfilenoSIGPROCMASKversion_numdefaultfoldercontextstrcatstrncasecmpdistcompsreallocstrrchrvsnprintfgetusrhostableganspsequencepostprocfdopen_exitpackprocm_readefsmhlprocadvertiseexeclpmypathenvironEveryoneperrorpophosterrnobrkstringunlinkr1bindexstrchrsethostentfreeclosePrintFoldersclosedirfoldprotm_Eomstrcmpcontext_replaceadiosfgetsm_atoimaildeliveryfaceproc_edata_PROCEDURE_LINKAGE_TABLE_fopenCompareFoldersmh_seqstrcpymhlformatmhlforwardm_getfld_etextcopyip_lib_versionfflushseq_readSIGNAL2sendprocshowprocpfolderclientname_ctypeinstallprocrcvstoreprocgetgidunputenvGetFolderOrdermainusequencermfproc.div__filbufchmodadmonishmemcpystrlenAddFoldermkstempstatseq_getnumprint_swwhatnowprocgetanswer_finicopydonemailprocfprintfgetcpysigprocmasktrimcpyctxpathisattym_defsmakedirconcatlibsocket.so.1libnsl.so.1libc.so.1t/D\RhUtaci;(4@LXdp|^)' $0<H]T`lvxz(KOLsN6? ,8AD#PW\{ht.!gF @D# @Z_ @Z@, @ t"@@Z@Z㿐@/Z/ZȮ  `    㿐 _@ZԒaP@@ /!$#@Z@@ J? s "a@/#" P@_aX_@`@ђP@ΐ`P"@Z ?"a@"!DP }T'I#\?#@1/ -+)L -^ + @z  8a@* ''((D(L(((T(\(d(l(|(t(t(|''Ȑ@@Đ  _ah@5#_@Ztax@t @ @#@ @ `L - _@a""!H %%%%%a%a%!%!"! "!" D`"D!@*`" @ `_@! 2  _!@! @Z- !@o!L@Z)_@m!P!!H`"L@z!$!H@@Y !tLax@ZP@@L 㿐 _@b!ȦA!/-L   !L 2M   !L  "hlap@ $lh%l* , @@Y"`$@@Y͔@`*㿐!@Y!L?#!L_@la#aD "%* @! ?!L@Y!@@  aD%@, @@@ aD 0! "@_!!L@ h@Y?'|<  !_a@Y  !@{ ! `  @`@Ya_@b_@YTa " Ph@YPI_` @YCa _@Y=b 2N` 7 .5@Y#N _@Y4b @Y1@Y"?"|<  !@ ! 2  @Y 㿐@,#at!!xa|@!xat$!x* , @@$@ & @@& L !H` @q?   * " * @ 2 " #`%at!!xa|@ؔ!xat$!x* , @@? $@  *@ & & & & @& & @ 㻀   !  ax @)_'  t"(@@X`x@ 0|ax @6#%  t@XM4t` x`4` 4` 2 x`@ !x @Q'_"X _"_"_!P t@X8!L t@_b0@_b8@Xt   _"@ @X.!@&@#t@aH "#\#\#\#`t #d@X!x`@ 㿐 @X  㿐! `&@W@㿐@  *` &@@W  &&@*`@ @Wۓ*`&㿐 !!l@W !l 83 ah@@W @.@W@? @J@ *2 `%`@W " J? *  @W? !l Φ㻐_@Wbb@WZ@2 ܀ %@ " L@@ 2  ΐ 2㿐@L@ / ~`00E@Wc /"L`. L`   @WY 2   /.?!P_#_#@W  /.?@WB ?@ g@W: ?!P_c @V@W. ?" "@"@ `"@ 㿐 `b@`@㿐  " $@V $  @V $  $ @V @V@ @V͠@Vh?@V @V 2&  `@[b& & && & & & & & @Vɒ ?"  @V@$  & $@V  `@9b@V?` @M"!L`   @V,2 `@!b $ & &&  `& *`% + ,Ԁ .`@V^c ː`c@Vo   & @VZ`&  &   d& "  @V)*  &  `@ c  4    $* "@  $      "@*`   "  @V@㿐`#8@V`@V#H`#``@h @ N#`@V #p@Uې@`}`#)``N " `@@ "k`@@&g``  N 2@J n2@J o2@@@U͐ @`` "  @2@@ 0 (/pq` # /q /r /s /t@U/u@  @ @,`@  ), @  @,`  # p  `##@@U```@ `㿐`a#@U}@ {!& $& (@#& " aK ]$` @ `@UxcP O! ppp$@P= ,=$=$=$===@ Epp$@6@@ 5p@ "@Z@U @ (p@ p@M 0 `c`c@ @U*@T  `܀5 +a@ *` "+ @T"$% J@ -2   @@T` 2 @ @"*@ @?"     *@ &  2㿐!@T  $`? $  $@T   ,@8  $ *` "   $  $ ,@T@T}M?`$ ""`$@Tt"`(a`a@@ 5 * @@T -.@`@.@$"``@& 2&  &  4    $*   " $`@ @T1J  *`8 @ *   (?J  㿐@! ܀ 2 @T  $ ܐ a@ `5 %a#@ ^ 2  @T 4L  2  @@   @S@  ax$ `,ax ۠@SА  $  a@ ` @ $@ $  ,  ax$  *ax㿐!"|  !""@S$ $"| a@ f`p )' " &Na%"|@SǓ*` $| a@ R`N@+  . @! |.|& "@  @ 2 ` *  2: `Ǥ`" J@ @* 8(8` J@ @ 㿐 $   $@S_   $  ?J2 ? ?:J !p ! Ѐ 2.aa@Sc $ @SU@S_ "   ` J@   a@ ǒ`!@ /$ !@R  Д@ aJ /"*a @S7aL @ #$apa@S#`耢 'dapa@ `L /Nap@Ka @ "apa@S`耢 ;'d@S`  a!a@ va@S!@S@R@Saa a0"(@R #a@Ra8@R"(@R?@Y   !pa@RӒ`耢 'd a@ LaH d@ @Rda@ !`>aK 9 / $a@ h@Rw @Rh?'a Ԁ a@ apa!a@7 @b  aa@ @RS@ 2a aa@ a@R!L " @@ _"`a@Rn`耢  'd d@ @Rgd㿀'H'L'P'T'X@R H` @R`@R  a@ Œb@H` @`㿐!"  @RN#@RO@ $""  @a㻐)#a"0@Q@R7#!#? %#@R0 `$ @ ?;:# ``",@R, ,O ?2a@Q̐"8@ ˠ#a@QĐbH  2a@u 6?a"Pa"`a"h @Qa    #@ S a@ @c0fS ppp$@S,L0L0L0M@M@Md@QZ 2& a@ c&` $` @yp$@@tpp$@e@5@T$`@Q< ,``"@@Jp$`,`"` "@@Q= "   2@ ac b`@Δ"#@㿐`b 0`b 0@P@P@P b@`8@Q[@QW.N@ @P㿐? '@Q@ `'  @` F J@ @  #H`7 @ 1cH '% ? '@Q `'  @` J@ #H@ 2#H``@ 2` S#. @OROTO` `-|` ? '@PՐ `'  @`2` 2`,? '@P `'  @` O J@ @0  #H`װ @ Ұ cH 1'% ? '@P `'  @` J@ #H@ 2#H``@ 2`@Ps" .       , $ , `:` ?$ # @PQ?`:., b``@?' ?'`:` % 4 ., b`@p ̰? ! @   * , , '?'  @@A  `@  &@$@ $ @ @O%   ?,@O  2` "` "|  ?' `u'  ?' ` @' /`-!\!!T@ɖ&@"  aP* @!T@@ @" @ &@  ?@O "@'' )" #., b`@?  &@ @Os' "'  "@''  b`@,$"`㿀% $ @O]  @OY #b`@O   $ b!#P? &@O/ `&  @ ",, @O5 `T "bJ 2b!"`T T "` @N@N' $T* #!T*"\T$ad$ @N"` ad! `$!X b@?a!@N T"aP!X  : L* "  *L` / #!? &@NȐ `&  @ `J #H@; 2#H`@ 2@N㿐 "#H "  * "a\!T"!X "` !T! @N$ "a\ !d@"X㿀@N !!d@N!d  a`@N.   0@No @? &@@NS% ` &`    #P@? &@@N> ``&` @  &,, , 㿐#P@M 7 'b @M r" @@Mޔ  @N,  @MՒ "baP$@@M L@ba`$@@ML@L@ "`ba` @M*#P  " @@`(`8J (`8 (J    KJ   *K *J @ ? $  @ `  㻈@'@M#@M|@MŠ&@MA% / @Me /.@Me   Ԁ I@M! E.@M!퀢?Cb;@M`?  %b!b.a@MT!b@MU!@M>@MTb!@M b!@M #b@MIa@MJ@L?@?cb@”   0bah@ 0b@<!؀ "t@ @M\㿐    @MUL?Р  @ ?А p ax C ?@C*ax>@M>@M> @M; @M8 @M5  @>! b@LҒa袒 b@Ka ܀ %bL  "  @Lג 2L @L @@Le 㿐@L@L ?@L? ?@L  ?  @L@L@L@L@?h@LԐ@LԒ @Lђ  @ڔА@LҔ  @ϔ??́㿐 >  Bc@Lp`c`6 5?#1  .c@L\`c`@LW  #P, @ c c c!@LB0 c!c!c!@L5㿐@KӐ@KА@KА ca(@K˖!t   @M 2$$  ``@K*  !t    `"@   `.`"`.`""!t 㿐!t@ 2  2 2    `@ 2`@ $"@  J@=   J@J`J J=`?㿐@KP'Ԑ@KЀ 'А 'А@K ?P @K  '@KȲЀ 'А 'А@Kє ?㿐?4?&1> @K`)   @&   JK K  2  J "ܰ&??&:   2 㿐N! @   N 2 @JԐ?@ !J@ "N*@@:J@N ! J@ 2*@`J@ 2 @ߐ㿐@E @JJ /"*㻐N /*ca8@JƔ  #c@Ja@ c@JaH caP@J  !!h@Jɐ@@J|0@g 㿐2L@@ L@ /ca8@J  c@Joa@ c@JiaH  caP@Jz  1!h@JK0*!hc@!XcL  / `Аc@J2a`@J*c!8@ @N? / /. @J#1!h  *㿐@ @IJ /"*㻐`2(N !c@9!h@II@c!x!c/!p@Iޒ@&  @IА@@IԐ N /`2 !ca@I  c@IԒa c@IΒa  ca@Iߔ  !Y!!h @$!hc@Ia c@Ia B!h@I!h!h /@J !h@"`ca@I  " c@Ia  ca@I  cha@Ii&@ @I  2 cha@IW&@ @|㿐N /sL@ /k`L@ ." / "`` \`@][,@ L /" @I2ML@c@I<a  @8D,@c@I0a 2@(ߢ L@ /@@8L@@(Ԣ -,@ca@I0  2( L /?8L( `ca@I  2 L@`@HL@L@ 2L@㿐@Hΐ @Hΐ c@a@I20 @H 2. c@xa.㿐 " @!N  @ !찒N !㿐p ܀ " @ 2   2 㿐!l@I+$   c@Ga Ѐ`"cJ@ " c@Hx@H?1c bb `l*l@Hs* 1@HZ?@ (1J@ /"*@ 1!l㿐'L'P'T'X @L㿐'L'P'T'X @L@ 㿐'L'P'T'Xcb@L! Ԡ#@H@H #`PJ@  'P@H 'Tc"@H 'X'\`$@$@@H$` '`N c" @G$@$``$@@G$``c"@G$@$``@H  $@$c(@$@@G@$```cN@ "cc"8@G$@$``$@@Gǐ$``c"@@G$@$``@H#P$@ @Hl:㿐@G `cH2Jc HJ@ *8` J  㿐 `c"P2c"P@G@`@G  `@G@G&  㿐" @Gސ@`@Gِ  `@GԐ@G& 2 㿐'P'T'X@Px ؐ@GR`@G4?@Gc@GbX@G'?@G @G @Gi?:. &@@G $. .@GS㻐a(  ]"a( 0d@GA`0U!)$@G ?@G% 9*@O #" @G :,,@`L@   !,@`L@ 2,@   @F "  2 ǐ@ "@F@Gy \"`X@Gt "`|㻐N N \!`\" @,N f";  n b"6 4   \"0,  t) N% ?#,  2N, ,N 0    ! @FN N @`?а? , N  ,@FQ @FQ@F㺈Ja0 *a0d5 8 4J@ @G@F?@G @G "1@F51 8J  d!!0@FB`@ 8@F?1!0㺈Ja0 a0d 8 " ** K  * X "@K 2d@@E!ld@Eΐ p J !l@E !l@E .  1d`@Et@Ew1!l㿐J!l 1a!l㿐@/E/E` ? ???㿐㿠㿠Ghelpversionnototaltotalnofastfastnoalphaalphanoshowzeroshowzeronorecurserecursenoallallsequence name -%s unknown%s [+folder1 [+folder2 ...]][switches]missing argument to %spath./Flist-Orderunable to change directory to.can't open directory../%s %s%s+%-*s is unreadable %-*s has %*d in sequence %s%s; out of %*d (private) atr-%s-nmh-0.24 [compiled on archimedes.gregor.com at Sat Feb 28 04:28:32 EST 1998]nmh-0.24%s/%s/opt/RCnmh/etc/%syesno/opt/RCnmh/etc/mh.profile.mh_profilecurcomponentsreplcompsreplgroupcompsforwcompsdistcompsrcvdistcompsdigestcompsmhl.formatmhl.replymhl.forwarddraftInboxinboxCurrent-FolderUnseen-SequencePrevious-SequenceSequence-Negation/opt/RCnmh/lib/opt/RCnmh/etccontext.mh_sequences/opt/RCnmh/bin/mhbuild/bin/cat/opt/RCnmh/bin/refile/opt/RCnmh/bin/inc/opt/RCnmh/lib/install-mh/usr/bin/more/opt/RCnmh/bin/mhmail/opt/RCnmh/lib/mhl/opt/RCnmh/bin/msh/opt/RCnmh/bin/packf/opt/RCnmh/lib/post/opt/RCnmh/lib/rcvstore/opt/RCnmh/bin/rmf/opt/RCnmh/bin/send/opt/RCnmh/bin/mhn/opt/RCnmh/bin/whatnow/opt/RCnmh/bin/whom/usr/bin/vi/opt/RCnmh/etc/MailAliases07000644-%s ambiguous. It matches-unable to allocate folder storageunable to allocate storage@,unable to allocate storage for msgstatsUsage: %s switches are: - Profile: %s [no] %s%s %s[no]%s %s -- %s %s/%srno blank lines are permitted in %s%s is poorly formattedatr- unable to allocate profile storagebug: context_replace(key="%s",value="%s")unable to malloc array in brkstringunable to realloc array in brkstringHOMEno HOME envariableMHrunable to read/forkunable toinstall-mh-autounable to exec [install-mh aborted]path%s/%serror openingYour MH-directory "" doesn't exist; Create it? unable to access MH-directory "%s"unable to createMHCONTEXTunable to allocate string storage%sOptions are: %s %s: %s. unknownambiguouswhomprocwhatnowprocvmhprocshowprocshowmimeprocsendprocrmmprocrmfprocpostprocpackprocmshprocmoreprocmhlprocmailproclprocinstallprocincprocfileprocfaceprocbuildmimeprocmh-sequencescontextbug: m_readefs called but pump not primedunable to allocate profile storageno blank lines are permitted in %s%s is poorly formattedunable to allocate string storageeof encountered in field "%s"eol encountered in field "%s"field name "%s" exceeds %d bytesm_getfld() called with bogus state of %dFrom From  maildrop delimiter must be at least 2 bytesremote from%.*s!%.*s %.*s unable to create directoryforkunable to/bin/mkdirmkdir/usr/bin/mkdirunable to exec folder-protectwunable to write%s: %s SIGRTMAXSIGRTMINSIGCANCELSIGTHAWSIGFREEZESIGLWPSIGWAITINGfile size limit exceededcpu limit exceededprofile signalvirtual time alarmstopped (tty output)stopped (tty input)continuedstoppedstopped (signal)pollable event occurredurgent conditionwindow size changedpower faildeath of childuser-defined signal 2user-defined signal 1terminatedalarmbroken pipeinvalid system callsegmentation faultbus errorkilledfloating point exceptionEMT instructionIOT instructiontrace trapillegal hardware instructionquitinterrupthangup%s: exit %d signal %d (%s%s) , core dumped%s (core dumped)%s=%s./...../path%s/%s/%s%s/./...../%.*s%.*s/%sunable to allocate string storageunable to determine working directory/continuing...: Error %d, w+/opt/RCnmh/etc/mts.conf/var/mail/usr/spool/mail 0/opt/RCnmh/etc/hosts/usr/lib/sendmaillocalhost localnet/opt/RCnmh/etc/maildelivery-1noshelleveryonemaildeliverybbdomainpophostserversclientnamesendmailhostablemmailidmmdelim2mmdelim1uucplfiluucpldirmmdflfilmmdfldirsystemnamelocaldomainlocalnamermts.unknownThe Unknown User-ID (%d)SIGNATURE"%s"84M\h | |, r ,!! 00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000}@}8}0}(}}|||||||||~@8Hhx (08HXp8H8`x`x 8P` p`P H$8(0, 084<@DLPTX\`dxhp`P0(pX@(hXP@8(0/tmp/snprintfXXXXXX`xxxxxxxx 48<@DHLPT\`xdhh`lXpHt8x( @(#)SunOS 5.5.1 Generic May 1996as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2ld: (SGU) SunOS/ELF (LK-2.0 (S/I) - versioning).interp.hash.dynsym.dynstr.rela.bss.rela.plt.text.init.fini.rodata.got.dynamic.plt.data.ctors.dtors.bss.comment.shstrtab  @,,r!!$ )!!  3%H%HW@9||?||E||M R[,, `Hf00m88t@@y@0707010000cef8000081a400000064000000640000000134f82ba70000e038000000200000001b00000000000000000000001b00000004reloc/opt/RCnmh/bin/folderELF%44 (444/usr/lib/ld.so.1=CF*4,x$b%|pm^}LgYdMe~s{5t2D?Q'+Nl3k(#78WUoa<rwycu9v0h1zf"-JAK \`]ZE;:jP.>qGBi[XRH!&T/6n@)OISV_h!!%l    l ( p%t&/L8XELA8X¤f>rzxD\0P@pd^a4 ¨',3@pHOV´^Tc=hDk0@!pd}t Ȥ}`\|  ¼i \P\T °$!(2:EL$Y ch(r{U0$$xf0\h˜rX hh,&”/Rh:BlHȠRZTdPoHuHH0cD hl,@ȨLF (%X4=@4EOlW,`fLn w~ZpD,,z0@0X(€œ x`'D/ 7DAxdHQotVŒ`ipvp\pp|D(tbDLi@ a`8"(1:~8@@PG]PWx8]cZlja(u¬l  lts >8 8UT #„+6  !=¸IVL](f&X kˆu}\<4h`8 hPS nd ,0 (x&x.5|<dDmuucpldirmhlreply_startsigemptysetmmdfldirmts_initcontext_findcallocfolder_readbuildmimeprocfolder_packvmhprocget_returnpathmh_defaultsatoiforwcompsgetcwdSIGNALfolder_freedefpathsetuidfreadseq_listseq_setprevgetpwuidnsequencemoreprocuucplfilcatprocvfprintf_environ_endstrdupshowmimeprocpidwaitmmdlm1mmdlm2incprocforketcpath_iobrcvdistcompsreaddir_GLOBAL_OFFSET_TABLE_msg_stylem_eomsbrsleepctxflagssigactionSystemNameinbox__ctypelprocgethostbynamecontext_readpathatooifileprocfseekmkdirsmatchsigaddsetgeteuidstrcasecmpatexitcontext_savebb_domainexitpidstatusstrerrorprint_versionsigmsgversion_strdraftseq_addmsgwhomproctoloweraccessLocalNamedigestcompsmallocmhetcdirsprintfmshprocNoShelladdunamegetfolderopendiranoyesmhlibdirprint_helpmsgprot_initmsg_countserversreplcompscomponents.umulm_mailpathmh_profile_filbufadviseseq_addselm_putenvssequalftellwritevmmdflfilpwdgetfullnamegetuidvforkmsg_delimm_maildirm_convertungetcgetpwnamfclosegetenvreplgroupcompssendmailambigswAliasFilewaitpidsnprintfsysedcurrent_DYNAMICrenameseq_saveinvo_namestrncmpchdirm_unknownprintf__iobexeclsetgidsetlocalermmprocfilenoSIGPROCMASKversion_numdefaultfoldercontextstrcatstrncasecmpdistcompsreallocstrrchrvsnprintfgetusrhostableganspsequencepostprocfdopen_exitpackprocm_readefsmhlproccontext_deladvertiseexeclpmypathenvironEveryoneperrorpophostfolder_reallocerrnobrkstringunlinkr1bindexstrchrm_namesethostentfreecloseclosedirfoldprotm_Eomstrcmpcontext_replaceadiosfgetsm_atoiseq_setcurmaildeliveryfaceproc_edata_PROCEDURE_LINKAGE_TABLE_fopenmh_seqstrcpymhlformatmhlforwardm_getfld_etextcopyip_lib_versionfflushseq_readSIGNAL2sendprocshowprocpfolderclientname_ctypeinstallprocrcvstoreprocgetgidunputenvmainusequencermfproc.div__filbufchmodadmonishmemcpystrlenseq_nameokmkstempstatseq_getnumprint_swwhatnowprocgetanswer_finicopydonemailprocfprintfgetcpysigprocmasktrimcpyctxpathisattym_defsmakedirconcatlibsocket.so.1libnsl.so.1libc.so.120 GTWfad ,8DP\hlt>"Q4(4,@LXd(p|`y~)N R$O0<HvT:`BlxD$Y1jI @D# @fh!@e@, @ "@@e@e㿐@/e/eЮ  `    㿐    h@eӒb@@ƒ /!$ ,@@eή ?#\@# J? s  "b @Q ,"?@hbh@Ӕ?c@ #@`@?#@@`  ;95L@ - +`@a(  * I# ((0((((((((()) ))$)8)D)P)p)x)`)h))(x(D@a(@ސ  hb@O ,h@eaba(@  @̐ @ - ,@ǐ i#b f#" c#a?_#!a ['aY'aV#"?R#b! N'!L'! H&F&b A"b>"";""?7""5 3 1 /   +   ' L@ + @?h @b +`` @ `#\  h@ْb?c\@#@`K h@s# 2 hh#(@ @dh@Q"hc0@ܔ   "a؀ " L3@R" " @hbh@ Ӕ@h@c8@" @`3hb@’@`@d" " @  @ hb@ @ @@ i>h @]cH@" " @hbh@ @h@Fcp "@`3hb@o@l`" @ /0@ " @dA  @@d: ?h@c"@  @ 1h#@ @d#@" "h@fhbh@ '  !h@d # 2@ch@d"2@f  d"!@c! "a h@ϒc"!@c* "a h@Òc" " >"?#\   i?c\@@@`@{"@Iaܢh"@ci@y 00o!ܐ@c?#\@ "@ @" Y@_0U!@ @c@@c?cp@c ?1!t i@^`8! ?i HiX@r @ @Ր @cd@͐ @; 2 i``@8?c\@@@A!܀ "@ -@@@ 㻐#b%!!@cE$b?!i@`@c5@*b6'#.  @ @c-`@" """"㿈 '"!""@  d#!!!*"@ @c*` $! i@ג`%,`"@*`"""" ""@Y"@b Z"  ! `! O@  ' i`@a `"@ " ! !@쀢?@ @ @" ! ,`a"* """" @ "#" "@A " " "!  ,`"a* @`  ,`"a* @` 2+x     b @1 -  @bJ4 b4 4 @4   4䀢4  " b`@֠ @@@@$ "`i"  ! 2`i!(#\ #`i!0#d #hi!8#li  i i!@a`"  ! " " @%i!xi!+hi!i!Р ! i@aː!Hk@aڐ!܀ @hc@iaP@a  i!X @aMi!p @a     @ab%ih"! #\@a#```  ` i!@ap    @adbi@aa!"`@ "`" %!  `" h@aC"" `i! s""hi!"@a0 @a< @㿐 @a=  㿐@% "     @  @ @+@y 0i@b @` /.,h@ac(  @`h? D@ai@Вb009`4/i-i$@` , @`0 ""@`P "@` `@`ƒ@`ƒh? `|<  `@ `@`̐,㿐"܀ `d"!!@`*` $! i@sbX@ݐb $' , @% b? * @"`b $b"@  `"!*`" J` J2J@J@2J@ 㻐iL@`>b@`9@ :!| %@ " @@ 2   2㿐@ L@ / ~`00E@`< /"L`. L`  !p@`2 2   /.?!i"i"@_  /.?@_ ?@o@_ ?!ic@_ה@_ڒ ?" "@"@ `"@ 㷐  @J 2& j@bpZ?jb@T? G   &* @ "9 "5`@u@_@p@_`j"@_@_?Ӑ 2 $ @f  $@&* *`"     $ $  "$ `  $    $$  㿐 jb@)j@㿐  " $@_? $  @_8 $  $ @_1 @_/@@_I@_1h?@_ @_" 2&  j@b& & && & & & & & @_  ?"  @_4@$  & $@_  j@Ւc@_?` @"!L`   @^,2 j@c $ & &&  `& *`% + ,Ԁ .j@^גc8 ːjc@@^   & @^Ӑ`&  &   d& "  @^*  &  j@}cH  4    $* "@  $      "@*`   "  @^u@O㿐` jcp@M4 jc@E@  jc@;  6  k`@0 @2  P @& @^E* !   " "* *`$  $ @^% &  &`@^6*` &  k@`P" &   &   "* "@&        "* "@ $ 㿐@? V E 4R    k@]`x 2   `3 k@]` k @5 " !L  - : -a kJ`@  -W : @ 4 `*Q#*`@GGGGG k` k`@f  k` @^  ka ka(@S  k@MaH߰ !J  @4   kah4@ & @ 2e  L - +? "a @]L"! @ " L  L 2 L 2|!쀣  @ɐ 6@ @ &  @4@   4  "* @ " $ & 4^@  Y "    $@* `)"@@   $@* @ ?k@\a k@\a   k`ka@ 0,% $@*  ` `  "``"``2`#    `& @ 6 &  @4& `@ $ 4 㿀 "!N@"! "`J@ 2`!$!@\  ! J 2`2 ` ??.2*@@*@`N@"!  `."@*@"!k@\ha    2j  2f?dk@\Xa ? "a  T R?k@\Fa k@\@a   B@?k@\4a  ?  "!  " *  2&  "  ?k@\aȀ 2? @` 4?  " *  2  " ?㿐    k@[a k!@A 2 @S"L  @2  @[@ "!N@ "!L "L L 2 L :f`L`"! @ 9 k@[a ? "a 4J HF k@[aȀ   "!쀢 9 7k@[a ."!k@[a 2??$"a쀢`+`-``?"a@[L"! @ " L  L 2 L ",@q?,@@Œ` :,@ c !쀢 $ C` *@! <   "* @   2+    "* @ "!  "*   "    `&  6 &  4&   6   ? k!k!k! @?㿐k!@ZΒk@Zː"k" k@( @F ,k@Z"0@Z@`}k"@)k`N " `@@ "k`@@&g``  N 2@J n2@J o2@@@Z @`` "  @2@@ 0 (/pqk "@ /q /r /s /t@Z]/u@  @ @,`@  ), @  @,`  "H p  k"P"H@@Z@```@ `㿐kb$"`@Z.@s"L& $& (@& " aK ]$k @ܔpk@ZGbxP U"ppp$@H= ,V(V(V(VVV@=pp$@.@@-p@ @Z@YӐ @ p@ p@M 0 kbkb@@Y@Y  a|5 +k@"b "+ @Y"$% J@ -2   @@Y` 2 @@"*@@?"     *@ &  2㿐"L@Y  $`? $  $@Y   ,@8  $ *` "   $  $ ,@YK@YIM?`$ ""`$@Y@"`(kbk@OТ@ 5 * @@YW -.@`@.@$"``@& 2&  &  4    $*   " $`@ @XJ  !*`8 @ *   (?J  p   ?@& "   K  $k @ $  &  $ _ k"$ $k @ $@2 @_D     *@ @6 @M+@Xϒ@XА?@XŒk@ub@XÐ@XÒ @X @X @X  @ :Аkc $@X  $ "  @X @ &.` .`@X.`: & 㿐@H !| "- 'k%@Β 2L  ` @(` $` %!|@X-  @X'@X%   , 2 㿐@!!| 2 @X  $!| k@ c05!|%k#@ 2  @X 4L  2  X@   @W@ 9 b$ `,b ۠@W  $  k@ c0 @ #$@ $  ,  b$  *b㿐!# 2$"#@WÐ$ $#  k@ c"L@Wʒ   %!k @#@W{ @'2s  @i ` *  )  $@* @ "X "U c #$ ΀@c %#@W c  k@ Tcc $&c c  ,@Ak@WZc@WU `@   $@ * @ "$@ $@ * @   `@ $@*  $@ $@ $  @k@W/c@W* `@$ # ` 㿐1!k@Wc01k#㿐bL?@  㿐@ " @ Skcl@ ?@u   @V㿐!#  !"#@V$ $# l@ ` )' # &Na%#@V*` $ l@ `0N@+  . @! .& "@  @ 2 ` *  2: `Ǥ`" J@ @* 8(8` J@ @ 㿐 @   "L@V 2 $ $  $    $@V   $ ``  l`X @ ,b @V,`@ "`$ l@ `U "`(2"  4 ` * 8  " *` "  $   ` *   "*  "  "  $ ` .*@$    ``  *@ $   *@* $    $ 㿐 @ n  "L@U "$  $    $@U   $ ``  l`X @ K @V,`@ "`$ l@ `> "`(2  ` * 8  " *` "  $ `   & *` *  "          * $    $ 㿐 $   $@U   $  ?㿐  N  l@ 0`@ l@Um` &l@Ug`  l@Ua` l@U[`Ȁ l@UU`Ѐ l@UO`؀ N"! @ 2 N  l`@    J@ `J@ 2  J2 ? ?:J " !!p 2.ll@UI! $!p@U&@UE "   ` J@   l@ ǒa!@ /$!p!@T!p!p@ lJ /"*l! @UlL @ #$bl@Ta( 'dbl@ a0L /Nb@Ka@!pH@ "bl@Tߒa( ;'d@T`  l!Hl@ vaP@T!@T@T@Tla`lp"@T  Pl@TȒax@T"@Tm?@Y   "l@Ta( 'd l@ La!|dH@ @Tdl@ !>lK 9 / $lp@ @TT @TSh?'l!t l@ al!l@7 @b  la@ @T'@ 2l lb @ l@Tk"8L "@@ _"axl@TEa(  'd d@ @T>d㿀'H'L'P'T'X@S H` @S`@S l@ ŒbH@H` @`㿐!#  @T1 0@T2@ $##  @b,㻐) 0l"p@S@S @"! 0? % 0@T `$ @ ?;: 0 ``",@S, ,O ?2l@S"x@ ˠ#l@S}b  2l@u 6?l"l"l" @Sel    #؀ \ l@ @c0f\ ppp$@S,qqqr$r$rH@S= 2& m@ `&` $` @yp$@@tpp$@e@5@T$`@S ,``"@@Jp$`,`# ` # @@S "   2@ m`0 m`X@Δ"#؁㿐`m p`m p@RҐ@Rϐ@Rڐ m@`x@S;@S7.N@ @R㿐? '@S  `'  @` F J@ @  #`7 @ 1c '% ? '@R `'  @`ऀ J@ #@ 2#``@ 2` ] . @twtxt` `-|` ? '@R `'  @`2` 2`,? '@R `'  @` O J@ @0  #`װ @ Ұ c 1'% ? '@Rn `'  @`ऀ J@ #@ 2#``@ 2`@RS" .       , $ , `:` ?$ # @R1?`:., m`@?' ?'`:` % 4 ., m`@p ̰? "! @   * , , '?'  @@A  `@  &@$@ $ @ @QԔ%   ?,@QϦ  2` "` "|  ?' `u'  ?' ` @' /`-"!!@ɖ&@"  a* @!@@ @" @ &@  ?@Qn "@'' )" #., m`@?  &@ @QS' "'  "@''  ma@,$"`㿀% $@Q=  @Q9 #ma8@P   $m!@#? &@Q `&  @ ",, @Q `쀢 "mJ 2m!H"`  "`@Px@P' $* #!*"$b$ @Pq" b! `$! m@?aP!@Pޒ "a!  : L* "  *L` / #!? &@P `&  @ऀ `J #@; 2#`@ 2@P㿐 "# " * "b!"! "`!! @O$ "b "@"㿀@Ph !"@Pc"  b@P   0@PO @? &@@P3% ` &`    #@? &@@P ``&` @  &,, , 㿐#@O 7 'm @O r" @O  @P   @O "ma$@@Oq L@ma$@@OiL@L@ "`ma @O]*#  " @@`(`8J (`8 (J    KJ   *K *J @ ? $  @ `  㻈@'@O1 @@OM@O&@O% / @O6 /.@O    t I@O! E.@O!퀢?Cm;@OF?  %m!m.a@O:!m@O;!@O@O:m!@Og m!@Oa  Pm@Ob@O-@N?@?`@m@”   0ma@ 0m@<" #@ @O<㿐    @O5L?Р  @ ?А p b C ?@C*b>@Nǐ@Nǒ @NĒ @N @N  @>!!xm@Nb(!xm@Kb0!| %mL  "  @N@ 2L @N @@N< 㿐@Nv@NΠ ?@N? ?@Nѐ  ?  @N@N@NX@N@?h@N]@N] @NZ  @ڔА@N  @ϔ??́㿐 >  Bn@N;ana6 5?#1  .n@N'ana@N"  #, @ n!(n!8n!H@N 0 n!Pn!Xn!H@N㿐@M@M@M nah@M"   @M 2$$  ``@M*  "    `"@   `.`"`.`""" 㿐"@ 2  2 2    `@ 2`@ $"@  J@=   J@J`J J=`?㿐@M֔P'Ԑ@MoЀ 'А 'А@Mɔ ?P @M  '@MQЀ 'А 'А@M ?㿐?4?&1> @L`)   @&   JK K  2  J "ܰ&??&:   2 㿐N"! @   N 2 @L?@ "!J@ "N*@@:J@N "! J@ 2*@`J@ 2 @ߐ㿐@E @L~J /"*㻐N /*nax@L  #n@La n@La na@L  !" @Laɐ@@LY0@g 㿐2L@@ L@ /nax@Lm  n@LLa n@LFa  na@LZ  1" @L(0*" n@!nL  / apn@La@Ln!x@ @N? / /. @L1"   *㿐@ @KJ /"*㻐`2(N !n@9!@KI@n!!n/!@K@&  @K@@K N /`2 !na@KҔ  n@KaȀ n@KaЀ  na@K  !Y!" @$" n@KaȀ n@Ka B" @Ke" "  /@K " @"`na@K  " n@KmaЀ  na@Kf  n a@K=&@ @Kq  2 n a@K+&@ @|㿐N /sL@ /k`L@ ." / "`` \`@][,@ L /" @KML@n@KaȀ  @8D,@n@K aЀ 2@(ߢ L@ /@@8L@@(Ԣ -,@na@K  2( L /?8L( `na@J  2 L@`@JŢL@L@ 2L@㿐@J @J n@a@K0 @J 2. n@xa.㿐 " @"N  @ "|N "㿐p!| " @ 2   2 㿐"@K$   n@Gb!p`"nJ@ " n@JU@JY?1n b@b@ `*@JM* 1@J1?@ (1J@ /"*@ 1"㿐'L'P'T'X @L㿐'L'P'T'X @L@ 㿐'L'P'T'XnbH@L!!t @@J@J  ,`PJ@  'P@I 'Tn"X@I'X'\`$@$@@Iא$` '`N n"`@I$@$``$@@Iǐ$``n"X@I$@$``@Jq  $@$nh@$@@I@$```nN@ "nn"x@I$@$``$@@I$``n"@I$@$``@J PP$@ @JF:㿐@I `n2Jn J@ *8` J  㿐 `n"2n"@Iِ@`@IԐ  `@Iϐ@I&  㿐" @I@`@I  `@I@I& 2 㿐'P'T'X@Px ؐ@I/`@IՐ4?@I\n@I͒b@Iː'?@Iɔ @I @I@?:. &@@Iv $. .@I*㻐a  ]"a o@I`pU"!)$@I ?@H 9*@O #" @H :,,@`L@   "!,@`L@ 2,@!  ! @H "  2 ǐ@ "@Hϐ@H "`@H!"a㻐N N \"!`\" @,N f";  n b"6 4   \"0,  t) N% ?#,  2N, ,N 0    "! @HܒN N @`?а? , N  ,@H( @H4@H㺈JaȀ *ao5 x J@ @H֐@H@HԐ @HՐ "1@H1 J  o!!Ȑ@Hǒ` @HĐ1!ȁ㺈JaȀ ao x J@ @H@G㻐Jb b@H@H' o@ "oJ 2 `o 1."  ".  .  #.  b.  !o.   . @G. @G0eK"` ` *:  <2 * ," * * K  * K 2 K"` >" ** K  * "@K 2o@@Gr"o@G  J "@Ge "@G~ .  1o`@GH@GT1"㿐J" 1a"㿐@/F/F㼮 ? ???㿐㿠㿠helpversionpoppushnoprintprintnolistlistnototaltotalnorecurserecursenoverboseverbosenopackpacknoheaderheadernofastfastnocreatecreatenoallallFolder-Stack -%s unknown%s [+folder] [msg] [switches]only one folder at a time!only one (current) message at a time!path.//no other foldersorry, no folders allowed with -popfolder stack emptyunable to find folder%s %sunable to allocate storage for folder namesunable to allocate storage for folder infono folder given for message %s.error on folderCreate folder ""? unable to create folder %sunable to change directory tounable to re-allocate storage for folder infounable to read folder %s%-*s %*s %-*s; %-*s %*s FOLDER# MESSAGES RANGECUR(OTHERS)%s %s+%-*s is unreadable %-*s has %*s messages%*snohas %*d message%s (%*d-%*d)s; cur=%*d;%*s (others). TOTAL = %d message%c in %d folder%s. only one message at a time!unable to read directory ..unable to re-allocate storage for folder namesatr-%s-nmh-0.24 [compiled on archimedes.gregor.com at Sat Feb 28 04:28:32 EST 1998]nmh-0.24%s/%s/opt/RCnmh/etc/%syesno/opt/RCnmh/etc/mh.profile.mh_profilecurcomponentsreplcompsreplgroupcompsforwcompsdistcompsrcvdistcompsdigestcompsmhl.formatmhl.replymhl.forwarddraftInboxinboxCurrent-FolderUnseen-SequencePrevious-SequenceSequence-Negation/opt/RCnmh/lib/opt/RCnmh/etccontext.mh_sequences/opt/RCnmh/bin/mhbuild/bin/cat/opt/RCnmh/bin/refile/opt/RCnmh/bin/inc/opt/RCnmh/lib/install-mh/usr/bin/more/opt/RCnmh/bin/mhmail/opt/RCnmh/lib/mhl/opt/RCnmh/bin/msh/opt/RCnmh/bin/packf/opt/RCnmh/lib/post/opt/RCnmh/lib/rcvstore/opt/RCnmh/bin/rmf/opt/RCnmh/bin/send/opt/RCnmh/bin/mhn/opt/RCnmh/bin/whatnow/opt/RCnmh/bin/whom/usr/bin/vi/opt/RCnmh/etc/MailAliases07000644unable to allocate folder storagemessage %s becomes %s unable to rename %s to-%s ambiguous. It matches-unable to allocate folder storageunable to allocate storage@,unable to allocate storage for msgstatsBUG: called folder_realloc with lo (%d) < 1BUG: called folder_realloc with hi (%d) < 1BUG: called folder_realloc with lo (%d) > mp->lowmsg (%d)BUG: called folder_realloc with hi (%d) < mp->hghmsg (%d)unable to reallocate message storagenewallfirst-lastillegal argument delimiter: `%c'(0%o)no %s messagemessage %s doesn't existmessage %s out of range 1-%dbad message list %sfolder full, no %s messageno messages match specificationno messages in range %scur.message %d doesn't existfirstlastprevnextcur:sequence %s %sfullemptyUsage: %s switches are: - Profile: %s [no] %s%s %s[no]%s %s -- %s %s/%srno blank lines are permitted in %s%s is poorly formattedatr- %s/%satr-%s-%swunable to write%s: %s bug: context_del(key="%s")unable to allocate profile storagebug: context_replace(key="%s",value="%s")unable to malloc storage in seq_list%sunable to realloc storage in seq_list-%s?%d unable to malloc array in brkstringunable to realloc array in brkstringonly %d sequences allowed (no room for %s)!strdup failedempty sequence namenewallfirstlastprevnextillegal sequence name: %sHOMEno HOME envariableMHrunable to read/forkunable toinstall-mh-autounable to exec [install-mh aborted]path%s/%serror openingYour MH-directory "" doesn't exist; Create it? unable to access MH-directory "%s"unable to createMHCONTEXTunable to allocate string storage%sOptions are: %s %s: %s. unknownambiguouswhomprocwhatnowprocvmhprocshowprocshowmimeprocsendprocrmmprocrmfprocpostprocpackprocmshprocmoreprocmhlprocmailproclprocinstallprocincprocfileprocfaceprocbuildmimeprocmh-sequencescontextbug: m_readefs called but pump not primedunable to allocate profile storageno blank lines are permitted in %s%s is poorly formattedunable to allocate string storageeof encountered in field "%s"eol encountered in field "%s"field name "%s" exceeds %d bytesm_getfld() called with bogus state of %dFrom From  maildrop delimiter must be at least 2 bytesremote from%.*s!%.*s %.*s unable to create directoryforkunable to/bin/mkdirmkdir/usr/bin/mkdirunable to exec folder-protectwunable to write%s: %s SIGRTMAXSIGRTMINSIGCANCELSIGTHAWSIGFREEZESIGLWPSIGWAITINGfile size limit exceededcpu limit exceededprofile signalvirtual time alarmstopped (tty output)stopped (tty input)continuedstoppedstopped (signal)pollable event occurredurgent conditionwindow size changedpower faildeath of childuser-defined signal 2user-defined signal 1terminatedalarmbroken pipeinvalid system callsegmentation faultbus errorkilledfloating point exceptionEMT instructionIOT instructiontrace trapillegal hardware instructionquitinterrupthangup%s: exit %d signal %d (%s%s) , core dumped%s (core dumped)%s=%s./...../path%s/%s/%s%s/./...../%.*s%.*s/%sunable to allocate string storageunable to determine working directory/continuing...: Error %d, w+/opt/RCnmh/etc/mts.conf/var/mail/usr/spool/mail 0/opt/RCnmh/etc/hosts/usr/lib/sendmaillocalhost localnet/opt/RCnmh/etc/maildelivery-1noshelleveryonemaildeliverybbdomainpophostserversclientnamesendmailhostablemmailidmmdelim2mmdelim1uucplfiluucpldirmmdflfilmmdfldirsystemnamelocaldomainlocalnamermts.unknownThe Unknown User-ID (%d)SIGNATURE"%s"KZf l h p l!! 00<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000xphXPH@0(  (HX`p(8Phx(@Xp@X0@`hœ ¤¬°´x¸p¼`XH@0 phX@(hPH8 xhXHp/tmp/snprintfXXXXXX 8X`P@0  xh`@(#)SunOS 5.5.1 Generic May 1996as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.2 dev 30 Nov 1995 GCC: (GNU) 2.7.2as: SC4.0 dev 15 Feb 1995 GCC: (GNU) 2.7.2ld: (SGU) SunOS/ELF (LK-2.0 (S/I) - versioning).interp.hash.dynsym.dynstr.rela.bss.rela.plt.text.init.fini.rodata.got.dynamic.plt.data.ctors.dtors.bss.comment.shstrtab  phhp!!$ )!!  3%%{9ll?E-M R[ll `((fmty ܉0707010000cef9000081a400000064000000640000000134f82ba800022b30000000200000001b00000000000000000000001900000004reloc/opt/RCnmh/bin/forwELF54(4 (44    ]T/usr/lib/ld.so.1yXa#?20p?]ZC+L-A5mWDg[">XsOxoqDB>uU3bEFzMFY~U0-`en7a'\#Mc1]T$@K=tP:Vf{dHZW*"!,wJqQwkv@(r)rk;N9E'< 71Glb^9_)ygl.`iAcm.4 hRj=8 u+P2K(/V<|OYI%$[h4G!Ns,&QJij*^Rvt3po6;  &d 5TBC/_LSx \n}6feI%8S:H $005l      PX`8 |l\l8P(,"ø+5t2<,98E0NSZCLc=(Xpwa$8|\(Ìä$2DPpm` p)41D9ArJ S<\txgoTxmdsd0.@DXDo@!ì4t   )&28=mhFPG\[amp ioux 7pP,pT3DAK,$d/ (0$%|+@2l>D DO8V@_g@ldsF\}ð <,tl`<ht؈ hPl#-D6t>\FÜPØ[0_eKnvPwH}u45ÐڬT>\0 DL@l04@h <4"=&-I,9cTD(KQ[4Leov}T01làT(@4H$B,DÔ ِL %,x06D?v<Eo|OU@]lXr#|Lo@$ (؄`$2(pAx$4!è+3Gxd:BBDLlSP\$tanpwPHT>,pmdl ` #p)XL3:At@JQpZt8allrXzJP(,ߌ άXtX rLLlp'L@Lp{0P >8  q( l &( 1h > G` N h  n uyD }vd$   P 4 ô ü d4 @0    p8  x |@ h 2   , !4 *| 3 ;X Fmp ! M U a  n| uu |1< P 6   $ r,  ,$    >4 <   T   t8 H  @ $` * $P 5  >< Jd T Z7@0 _DD dh j s { T$ <<   3 \ r  ` L r *x  uucpldirtwsortm_tmpfilgetadrxmhlreply_startrefilesigemptysetmmdfldirreadgmtimemts_initcontext_findcallocfolder_readbuildmimeprocmfgetsvmhproctwscopyget_returnpathatoimh_defaultsforwcompsgetcwdSIGNALfolder_freedefpathsetuidfreadseq_listseq_setprevgetpwuidnsequencedebugswsplitswdistouttimezonemoreprocuucplfildlocaltimecatprocvfprintftoupper_environ_endstrdupshowmimeprocismymboxpidwaitmmdlm1mmdlm2incprocforkgetpiddistfileetcpath_iobrcvdistcompsreaddir__flsbuf_GLOBAL_OFFSET_TABLE_msg_stylem_eomsbrsleeppipectxflagssigactionSystemNameinbox__ctypelprocabortgethostbynamecontext_readpathatooifileprocfseekmkdirsmatchsigaddsetgeteuidstrcasecmplequalatexitcontext_savebb_domainexitpidstatusstrerrorprint_versionalarmcreatsigmsgversion_strdraftseq_addmsgforwswwhomproctolowerpushaccessLocalNamedigestcompstw_dotwmallocmhetcdiruprfsprintfmshprocsymlinkNoShelladdunamegetfolderanoyescheck_charsetopendirauxformatmhlibdirprint_helpmsgprot_initmsg_countm_gmprotcpydataserversreplcompscomponentsdup.umulseekadrxdasctimefputsdgmtimem_mailpathmh_profile_filbuflkfcloseadviseseq_addseltimelkclose.remsetjmpm_scratchlkfopenm_putenvssequalm_backupftellwritevmmdflfilshowfilepwdsscanfgetfullnamedparsetimegetuidvforkmsg_delimm_maildirm_convertgetansungetcgetpwnamfcloseyyextragetenvreplgroupcompsdup2sendmailyymatchpushswambigswAliasFilesnprintbmktempwaitpidsnprintfsysedcurrentwrite_charset_8bit_DYNAMICrenamedtimezoneseq_savedtimeinvo_nametzsetstrncmpdecode_rfc2047chdirm_unknownprintf__iobexeclsetgidnew_fssetlocaletw_ldotwrmmprocyyvstopfilenoSIGPROCMASKversion_numdefaultfoldercontextstrcatstrncasecmpyycrankformataddrwritedistcompsreallocgetusrstrrchrvsnprintfyysvechostableganseuropeandatefmt_normpsequencepostproclkopenfdopenunique_exityytopstringdexpackprocm_readefsmhlproccontext_deladvertiseexeclpmypathenvironEveryoneperrorpophostfolder_reallocerrnobrkstringmnfreeunlinkr1bindexstrchrwantcompm_namesethostentlstatfreopenisfromfreegetmm_draftcloseadrsprintfdlocaltimenow_timezoneclosedirfoldprotfmt_scanopenm_Eomuucpadrxstrcmpset_dotwcontext_replaceadiosfgetssendsbrm_atoiseq_setcurmaildeliveryfaceproc_edata_PROCEDURE_LINKAGE_TABLE_fopenmemsetdmktimedtimenowmh_seqexecvpwhat_nowstrcpymhlformatmhlforwardtw_motyclosefdsm_getfld_etextcopyip_lib_versionfflushlex_stringseq_readSIGNAL2yybginsendprocshowprocannotatepfolderclientname_ctypecpydgstinstallprocrcvstoreprocgetgiddctimeunputenvaltmsgmainusequencegetnamermfprocfmt_mnull.divfmt_compilechmod__filbufadmonishinplacememcpystrlenannotextlinkseq_nameokmkstemplocaltimestatlseekseq_getnumprint_swwhatnowprocgetanswer_finicopydonefstat_cleanupfprintfmailprocWhatNowgetcpysigprocmasktrimcpylongjmpctxpathisattylegal_personverbswm_defsmakedirconcatlibsocket.so.1libnsl.so.1libc.so.1md?ompYr8hk((43@`LXdyp|pTHS1kZ  , $0<}HT`alx<\$Ia U,8DdP\qhitO V-!wSYo(4N@LXdAp3|J/s0eb oV$+0m<H^T=`lx\j[>_ @D# @9#@5@RV, @ d"@@*@+㿐@//㴮  `    㿐?b ?  ?㜆    ?㔆 ?㌆ ? ?#$@?t   ?l ?d  ?\  ?T  @ْaP@@62 /@A\"c|"?@AaX@3ޔ`?c@@ #@@`?#@@ `-%?#L - + @> `vN *`@89 9d9<==9:;L;;< ;;<;<>0:@s@P  ah@A]c|@xax@/ @? @/#|@: ??S ?N ?l@ ?l `?lH -? @A%?1 ?㌆?㌆' @" <``J@ -? @A?ㄆ ?T?T ?? ?d @@a@ `L - @@ڒ@? ?d @ `L - @@ƒ@`@@.к @ `N@R#@@ ô?? ? ` @ `M -  @@ @ `L - @@@@ `L - @@u@4@ a@@jz@?t @@^a@ `L -2L @@RL`+`@2L L`@ @?@>} `?tP  @@9b@`L -2C@ @@-=@?t ?4"@??* ?% L + @-?\ @@b8@ + ` @>5 `?\ @? H"@@ [`@?@?U?| @?"X  ?"`@> @?d  ?\?@?ƒbh?T#`@=L"?t  ?㼘@' @Ր?TV?'`?c@ɒ ?J"? -@+?# `@$2@n  @`@<  , P@ADAA?|@U ?`@3j` `@. ` "   @?HbȀ 2?d?^  ??`H""  \ ?@> ?\ ?\@<@\??@?"b?\@(A!  $!t ?\@?c!t   ? ?\@?c ?d ? Hat@)T 2`@ߐ `@ @0!t @ ? @>ޒc8 6 cH@ 2@>u@&  cX@ߔ@>c @   2#@  #@>@ْ ?2@>cp@0c@˒ ?cc@>cc@, #`@2@>{c@@?d ?d@ ? ?d@>]cА?d@ז@@P??@t#\0 `@ސ0@@r !cH@Lx!#@E@=@/#cX@;@7@=@/?\#̆@/!!t@0 @.B!t@9??@ ?㤆!t#\#`##`#`??|  #d?l#h?@5 @ \@ 耢?#@=’c  /@27 'H@`@ `0{ @=`@@ @ܢ  'L ('P'T` 0'X'\ 8'`!? X@#c@'d @'h!? X@@'l ,`` H X$0X3at# "@  H@=_`hat  ,` t`$`* @  t@/E@<`&pX`t  $t,` "0X! @H#@`@ @K?@mH@@f@9"?`@9?c㻐at  y     t$* @ "b`  2!!P@ 06 / / / / / / / /@7/t   $ Ȕ!P`Д@@ `, ,  , @@@.@ ?@<` @@`at t`@aP!t  ! !P@ @ڐ@ْ`a(@@ː  *,?   ,, @@㻐!t  !P!P Ȑ %t @l @@t  't`$`* @ "t@.,@Op@@t  ta`@w p @ @k!@x"P 1@d!x    2 2$ "$ "'1@Q!    2 "'@Iސ @;R$ '''''#|@)@@5a@;ϒc@0@1@2?!@;`@+2Ԑ @;aԒ@ؐ@@Ր@ @;a @  <\`h@0 /?``" " !@7`` @7! @8/!؀ ` O /!@7ޒa` @!@7Ғ@8!@ؐ!趒"@7Ēb@u"@7`@7" "@:"(" D@7b@V"0@7@7ڐ"8@7א"H@7Ԑ"Xb``` \ @`B"h``&* @ "4``""p"x@-@#@W`  ``$ * @ "?  $ ?  @,@b@9 `` $``"8@7<"H@78d@b"X@7/@6Q#@:?@? `@b ! @@  ! <@`@b@ < ?#l$    ?#h$ @@/ /@:2"c|"?@9`@,?c@v #@p`?#@@ `1U!<%?#l ?#hL -` @7!x  }* UdUxUVXVVVVUU@X!x@ 5  `@:Bc|@]`(!x@' @ $ @(#|@    @:+`@@ `L -2L @:hL`+`@2L L`@ @?@8J `< @: `@#`L ?,%@% `J -#  @9h `@""``J@ -2@ @9h @` @9ؒ`@@ n``2 L@@C ȢL@ 2 ?l@! @9&@. Р  L ?@9?#h 2@ $J 2$`@  `L `@`#\?#h@  @ 6@ g "#|@!V!<?#h?#p@2@@Đ @ M @@6~ }* Y`YYYZZ$ZZZ`@-Pߐ @96aِ`@A?Ӑ0H`@ "#\$`#\  @V?05`@-+`@z`@`J@ d -J` d @n?@9a 0 @/? a8@8@  `@G  @ ސ `@< `@' {@ ΐ w @8ΒaPq0?#Ę#?c@#@?##?c@#@?##?c@#@" ??#Ę@ 9?@8S!`?#Ę .#@ D?#Ę'#@cĚ@@ 2!?" /?cĚ@@- #?#Ę@ah@. @8'?#Ę#@?# 4?c@@` ?#K@ /\  ?c@@@\?#?#` @oap\` 7ap\@a?# @@? ?@ ?c@#@c@#@@3@#@?  \{!x@8a? ?@<\?c@@`?#  ?c@@ @4_!!@4[?cĚ@@@,d /?``" ?c@@`" ?#@ ?#?#@" `?##?#@ * ?``?#?c@" * " @@ #@a?cĚ@@@@?@3?G?cĚ@@@,  / @a ? #4 ?#@,"  "??c@@` `?#@?c@@@? a?#a@7H\??c@@b` R"b?# K?c@@  E??c@@`?cز@@ ?4?#@<  -?@A?%??cز@A@ ??#@ ?@l? @? ??#@6b?cĚ@@@6^"b?cĚ@@#?c@@`@E㻐@ &?@ " @6ڒb0@ ?'@P$ @"@6P?@@'D'<'4@6O"h 'L@bx 2@"  @< <@ ? @63" 'L@" @<  L#\ <   v  ,@* /@ɒb D9;"* <%c0,0),]|[0!$0`$c$#*@#* #2`*` @ @ؐ N  N@㿐  N `- N  `0N 0 !q @  `{, * ?Р N @  `{`(@O c؀`A #Ȑ :*@ 7*@2@pc؀`.#   #Ē"#"#   #Ā "#"#  *c* c#2`J "`! `2 #2 * 㿐L@!q @ ``-"`_"`}!H,Đ`""Ȑ *@* 2 NN "    `_ `ȑ*   "c̠ #@ #  $#%̀ ! @ $"`"NN "    `_ `ȗ* " " !#̀`B" `B`C`@`Am!0\!0` !X8   @ ,#"`*Đ`"$#Ȑ *@#* #2 NN "    `_ `ȑ*  $̠#@2 #  $#!#̀ 2 @ $#"`"NN "    `_ `ȗ* " " ##" `p "̀ @ Đ "̐ $"` 2`!#  !XВ# V""*@Đ`""Ȑ *@* 2 NN "    `_ `ȑ*   #@Β #  $#!#̀ 2 @+ $#"`"NN "    `_ `ȗ* " " ##" `  ` !X{` 2`㿐cؠ "cN!qN @  `( `{ ` `)!Z.?9!P!q @ LN `h"|*`@$`(`{!1Lc *N `-`?N !q @   * * ?ЖN @  2 Đ`"" *@* 2 u" ` ?`)".?N` .?Đ`"" *@* 2 \" Đ`"" *@* 2`LM"`!`"$# *@#* #@(2 #!`"$# *@#* #Ȑ @2`#-"`Đ`""Ȑ E*@* 2 " ?.L@'Ē"" **`Ȱ2`"`?.L@N "#Ѐ`)!cؐ?"c؁㿐N {  А#Ȑ *@ ( ) %? N <@4 !Y㿐!#ɐN ] "I#`$#"Ȑ F*@* Ȑ #2"`$#"Ȑ I*@* 2`"`$@ : 2`㿐  "(`#Đ": 4`#bЀ  @ 5@b8@%Rb@@@h?2@%Gb`@  $bА@%=b@b@ @%1bb@* ! "@$!$b@""ЁJ3     H\2$*Hn"*rb"* f ""* t" *** H؀\*㿐N@`V!q @  @NN    @@@2N @ N   / N``$` @  @{M      @n"L ``L``" N@`2 @ 㷐 "9 N "" N /21 cH@.   @1 ."". cP@  cX@  c`@w@|㿐@& @@ /  ch" @W p''ܬ ?I !q ?`V=k"(*`@ 88(X8@Pt (HT`8,HXl T$4D\l|XD( 8x X  `"ݰ  @ (" @` @ 2  @ ΢`:Ͱ   " @ - ("-` @ 2 - V     `D" @@$@&: -   (" @` @ 2  @ `   " @ - ("-` @ 2 -  @ `逥2k  ge -  L@ \`:[ -L@ V   L@ `,: -L@  ` :8 - "2  @ (" @` @ 2  @ #`:"   " @ - ("-` @ 2 - V   D" @@<$@&: -   (" @` @ 2  @ `   " @ - ("-` @ 2 -  @ `逥2°   -  @"cpS 0  --   , * ,  @J @F 0- @CV  & @& @1  0,@@) @8 ?@ -,@@(e @,@^ -Z  M@ 2R ZV  M   "C KV  2= EV  47 ?V ߮  +ـ)  #$Ϯ  @ɀ @ M6 M 2     `? @  4   V *  @K @!v 2 #  @ ݬ  א@ "Ұ Ϭ"Ͱ @ՒO   !qM 2V    @8-@?@ J@  *@@8J@$ @͐( @Ȑ" R    @ }  ܑ* x@@t%p#@ m j" `"f @b `"^ @ZX'  T  P   L   H    C    4ad   .b  ` @/w`(0  ,    ( 2& @00"    ( 2@0&  a   ( @0 a*        $ @/   $@/@n "   ( 2 @/   (    ( ۮ?ٮ    (Ԯ       @. ʬ               $   (  @          J  `"̀2` 8"/2 ( @O (@J )2} @ x*L@ 2u ,@@:L@n  Ò2h ? 2  _ c  c@UP M  $ '@.'@-  $ '@.'@-"@ "` "` "`  "` "` "` "` "`  $"`$ ("`( `" T @)*"T "@ "` "` "`  "` "` "` "` "`  $"`$ ("`(4  @ , @@" @L@&@ L@-L@  `D@@L@ , `@  2@@2@?$@ "@  -   -   $L-  L   @!qL @4 "  @ (" @` @ 2  @ `:   " @ - ("-` @ 2 -  "̀@"@ `!@Y  p@  !$@K# K !@C# "A$ "̀@"@y `)!@.#   @a !@'$4 @"! T    @M @ @4 !@# b$`?4  *M?  - - 㿐#c @~<"! $# @Ȓc!$c#"c!"c)#䀦  :# N % 1,@~+c"@&! ##$ "  c@ @~j$c%# $ @c#c %c,   ? )/-+3@  p@Ø #$  ; # ;,  #䀤 ,,  , $ "/@}"@ #䔢 $ "  c@ @~%c%# % @3c#c %$,   ?@ @}x"@& #䔢 $ "  c@ @}%c%# % @c#c %,   ?@T0| ;, ,"##㿐+%c)%#'$%$#$c !$# *# # @":  @|#   $# $c  $ $ %#"# `%cJ@ 1 @|ݐ1 #㿐 Jc c @|͒    `@ # ;# 7# 2# -# 2(  / /  /  /  /  /  /  /  /  / / / @/   `0# `# ` `H@}!    ``@M  @-  @| ,2& `@} )   @"`| @c`& @ & !# `9 &  . ##@s& c`^& $Y #   @f & @c#0& @| ! "  *@Y & @V# & (?. @P# c`& & & #  @>& & #   & @@g @ & # "@%& ## & @& $# @& (㿐 .  " @{  " @{ " @{  " @{  " $@{ $ " (@{ ( @{@{㿐N    `# @{ '` ?  #        @{h  `#  @{```2 1?#`2 (  "' ( ( ` #  @$  (@{@#"1  #  @$ @{01   #`@{%1 #@{(c1 #㿐`@/`1 @#`@{㻐!#  "#$@#$$` @} $# @ o$#  # ]     $ a@ɔ $J *  $ $ @{  @J *2 $* "J * $`$@z@J *2 $*@z! L "$ @Hca0@z  a`@V "   "#  ?$"@D@z @2  J .@e @   @c0 y #$`t#$ l@z @z{ &c  "   L L" @ 2KL@ "CL@ϒ &<L 2<   "4@zF@zB &* "   "   " @v 2 @ "   @ 6  2   PJ? `H* ?㿐    @z\ = 2N   #Ѐ"N =.@